Details for Capsella Locus Carubv10019330m

Position : scaf_5 ( 5`- 11175803 .. 11178187 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019330m

Protein [Map View]
MTKVCPEIEEETLPKSAVPVSADVSFASDHFPTYKLGPDNQIIEEPKEDDKGPSVKETVQKESELLSDQHKRLSVRDLAS
KFDKNLAAAVSLADEAKLREVASLEGHVMLKKLRDALEYMRGRTDGQNKEDVETAISMVEALAVKLTQNEGELIQEKFEV
KKLGNFLKQTSEDAKKLVNQEKSFACAEIETARAVVLKLGEAFEEQERISEASRAQGPDVEKLVKEVQEARQIKRMHHPT
KVMGMQHELHGLRNRIQEKYMNSVKLHKEIAIIKRVEESKSCPFVLEGTQSLGSCLRICINGLENAPDLSNCSIQWYRAA
CETSRREAISGAIQSIYAPEPFDVGRILQADILSNGQKFTVTTDDPVDPDSGLQSRVETLMRKSNSEFSVVISQMNGQDY
ASRSHIFTIGKTRIKLSRGWISKAREIYSTSMQLCGVRSNIKTPTKALFWQPRKSLSFILTFESEQERNAAIVLARKYAF
DCNVSKN*

DNA
ATGACTAAAGTGTGTCCTGAAATAGAAGAAGAGACATTGCCTAAGTCAGCTGTTCCAGTATCAGCAGATGTGAGCTTTGC
TTCTGATCATTTTCCAACATACAAACTAGGACCTGATAATCAGATAATAGAGGAACCTAAGGAAGATGATAAAGGTCCAT
CAGTGAAAGAGACTGTACAGAAAGAGAGCGAGCTCTTGTCTGATCAGCACAAGCGGCTTTCCGTCCGCGACCTTGCTAGT
AAGTTCGACAAGAATCTTGCTGCAGCTGTTAGTTTGGCTGATGAGGCTAAACTAAGAGAAGTGGCTTCTTTGGAGGGACA
TGTTATGTTGAAGAAGCTAAGGGATGCTTTAGAATACATGAGGGGACGCACGGATGGGCAAAACAAGGAAGATGTGGAAA
CAGCTATCTCCATGGTTGAAGCACTGGCTGTGAAGTTAACTCAAAATGAAGGTGAACTAATTCAAGAAAAGTTTGAAGTG
AAGAAGCTAGGAAACTTCCTCAAGCAGACTTCAGAAGATGCAAAGAAACTGGTAAATCAAGAAAAGTCATTCGCTTGTGC
TGAGATTGAAACTGCAAGGGCCGTTGTGCTGAAACTTGGAGAGGCATTTGAAGAACAAGAACGGATTTCTGAAGCTTCTA
GAGCTCAGGGGCCGGATGTGGAGAAATTGGTTAAGGAGGTTCAAGAAGCTAGGCAAATTAAACGGATGCATCACCCCACA
AAGGTGATGGGCATGCAACACGAGCTTCATGGTTTAAGGAATCGAATCCAAGAGAAGTATATGAATTCTGTTAAACTTCA
CAAAGAGATAGCAATAATCAAGAGAGTAGAAGAATCCAAGTCTTGTCCGTTTGTTCTGGAAGGCACACAAAGTCTCGGTT
CTTGCTTAAGAATCTGTATTAATGGTCTTGAAAATGCTCCTGATCTTTCCAACTGTTCGATCCAGTGGTATCGCGCAGCA
TGTGAAACTAGTCGAAGGGAAGCTATATCTGGTGCCATCCAATCGATATATGCTCCAGAACCATTCGATGTTGGGAGGAT
CTTACAGGCAGACATTCTTTCAAATGGACAAAAATTCACAGTTACAACCGATGATCCAGTTGATCCTGATTCTGGCTTGC
AGTCACGCGTAGAGACGCTGATGCGAAAATCTAACAGTGAATTCAGCGTGGTTATATCACAGATGAATGGACAAGACTAT
GCATCCCGGTCTCATATCTTTACCATTGGAAAGACAAGGATAAAGCTGTCTCGAGGATGGATCTCAAAGGCGAGAGAAAT
ATATTCGACATCCATGCAGCTCTGTGGAGTTAGAAGCAATATTAAGACTCCTACCAAGGCGTTGTTCTGGCAACCAAGAA
AGAGTCTAAGTTTCATTCTTACCTTTGAATCAGAACAAGAACGTAATGCAGCAATAGTCCTTGCTCGCAAATACGCTTTC
GATTGCAATGTAAGCAAAAACTAA