Details for Capsella Locus Carubv10019298m

Position : scaf_5 ( 5`- 11211328 .. 11211702 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019298m

Protein [Map View]
MAINTTTVTKSMAAAFFTIIAMAALASAATTGVVQPPESDHLVNRCMAKVSSRCAMYVTAEMYNHLHGPLKQNGCCLEVY
HMGRVCLHIVTRHVIETLMPKLEGVEKQDSLEKSTQIWYLCVSV*

DNA
ATGGCCATCAACACAACTACCGTCACCAAATCCATGGCTGCAGCCTTCTTCACAATCATCGCAATGGCTGCGTTGGCATC
TGCAGCTACCACCGGTGTGGTTCAGCCTCCTGAATCAGACCACTTGGTTAACCGATGTATGGCTAAGGTATCTTCAAGGT
GCGCGATGTACGTCACGGCCGAAATGTATAACCATCTCCATGGTCCGTTGAAACAAAACGGATGTTGTCTAGAAGTTTAT
CACATGGGACGTGTTTGCCTTCACATCGTGACAAGGCATGTAATCGAGACACTTATGCCCAAGCTTGAAGGTGTTGAGAA
ACAAGACTCTCTCGAGAAAAGCACACAAATATGGTATCTTTGTGTTTCGGTTTAG