Details for Capsella Locus Carubv10019268m

Position : scaf_5 ( 5`- 11187384 .. 11187695 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019268m

Protein [Map View]
MADEKSRKSLTSSGSRGSFKTKNPFSRVKDEDANKNKTRLSMKKSWSTDSLGLLSNSNRLGKTICICAPTKHEGSFRCRL
HRSSATSHGAAATQLHFPKPLPS*

DNA
ATGGCGGACGAGAAATCGAGGAAGAGCCTGACCAGCAGTGGCAGCAGAGGTTCATTCAAGACTAAGAATCCATTTAGCCG
TGTGAAGGATGAAGACGCCAACAAAAACAAGACAAGACTGTCTATGAAGAAGTCTTGGTCCACGGACTCGCTTGGTCTGC
TCAGCAACAGCAACCGGTTGGGGAAGACGATCTGTATATGTGCTCCTACAAAGCATGAAGGCTCATTCCGTTGCAGGCTT
CACCGTTCATCAGCCACAAGCCATGGTGCAGCTGCTACACAACTTCATTTCCCAAAGCCTTTGCCTTCTTGA