Details for Capsella Locus Carubv10019225m

Position : scaf_5 ( 5`- 11227378 .. 11229750 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019225m

Protein [Map View]
MMEAKPKRRIVTENGDTGEDLVLATLIGNGDDVGPLVRHAFEMGRPEPLVHQLKNVARKKEAEIEDLCKTHYEEFIVAVD
ELRGVLVDAEELKSDLASDNFRLQEVGSALLVKLEELLESYAIKKNVTEAIKMSKICVQALELCVKCNSYISEGQFYHAL
KTMDLIERSYLKLIPLKVLKLVIERRIPVIKSHIEKKVCSQFNEWLVHIRSSSKNIGQTAIGLTASARQREEEMLERQRR
AEEQNTGGLGELAYTLDVEDSEQDSLLKFDLTPLYRAYHIHTILGVPERFRDYYYENRLLQLKSDLQISYTQPFVESYQT
FLAQIAGYFIVEDRVIRTAGDFLLADQVETMWETAISKIVAVLENQFARMDSPTHLLLVKDYVTLLGTTLRQYGYEVGPV
LDALDKSRDKYHELLLEECRKQIVTAITEDSYQQMVIKKEADYENNVLSFNLQTSDIMPAFTYIAPFSSMVPDVCRIIRS
YIKGSVDYLSYGVNTNFFSVLRKYLDKILIDVLNEVILETISNNSIGVSQAMQIAANISFLEKASDYFLRHAAQLCGIPS
RSVERPQASLAAKVVLKTSRDAAYLALLNVVNTKLDEFMKLTENVNWTTEEMPQGPHEYMNEVVIYLETVMSTAQQILPM
DALYKVGVGAIEHISNSIVSTFLSDSIKRFNANAVSAINHDLRVIENFADERYHSSGLNEIYKEGSFRSYLVEARQLINL
LSSSQPENFMNPVIRERNYNTLDYKKVATICEKFKDSPDGIFGSLANRNTKLTAKKKSMDMLKKRLKEFN*

DNA
ATGATGGAGGCCAAACCAAAAAGGAGGATTGTTACAGAGAATGGAGATACAGGGGAGGATTTGGTTCTTGCTACATTGAT
TGGAAATGGTGATGATGTGGGTCCTCTTGTTAGGCATGCTTTTGAAATGGGGCGGCCTGAGCCTCTCGTTCATCAGCTCA
AAAATGTGGCCAGGAAGAAGGAAGCTGAGATTGAGGATCTATGCAAGACCCACTATGAAGAATTCATTGTTGCAGTTGAT
GAGCTCCGTGGTGTGCTGGTTGACGCTGAAGAGCTTAAGAGTGACCTTGCAAGTGATAATTTCCGCTTGCAAGAGGTTGG
TAGTGCCTTATTGGTAAAGCTGGAGGAGCTTCTCGAGTCTTATGCTATCAAAAAGAATGTAACTGAAGCTATTAAAATGT
CAAAGATCTGTGTTCAAGCACTGGAGCTGTGTGTTAAATGCAACAGTTACATATCTGAAGGTCAGTTTTACCATGCCCTG
AAAACCATGGATTTGATTGAAAGGAGCTACCTGAAGCTTATCCCACTTAAAGTTCTAAAGCTGGTAATAGAAAGAAGAAT
CCCAGTGATCAAATCACATATTGAGAAAAAAGTGTGCAGCCAATTTAATGAATGGCTTGTTCACATTAGGAGTTCCTCTA
AAAATATCGGACAGACTGCTATTGGCCTCACTGCTTCAGCTCGCCAGAGGGAAGAAGAAATGCTGGAACGTCAAAGGAGA
GCAGAGGAACAAAACACTGGGGGTTTGGGAGAACTGGCATACACTTTAGATGTTGAAGACTCGGAACAAGATTCTCTTTT
AAAGTTTGATCTGACACCTCTGTATCGAGCTTATCACATCCACACTATACTTGGCGTCCCAGAACGATTCCGTGACTATT
ACTATGAGAATAGGCTACTACAGCTCAAATCAGATCTGCAGATCTCTTACACACAGCCATTTGTGGAATCATACCAAACA
TTTCTAGCCCAGATTGCAGGGTATTTCATTGTGGAGGATCGGGTGATTAGGACAGCTGGAGATTTCTTGTTGGCTGATCA
AGTTGAGACAATGTGGGAAACAGCCATTTCCAAAATTGTAGCGGTATTGGAGAACCAATTTGCCAGAATGGATTCGCCTA
CTCATCTGCTTTTGGTGAAAGATTATGTAACTCTCCTTGGCACAACCCTTAGACAGTACGGTTATGAAGTGGGGCCAGTT
CTTGATGCTCTTGACAAGAGCCGAGATAAATACCACGAGCTTCTTCTTGAAGAGTGTCGAAAGCAAATTGTGACTGCTAT
TACAGAGGACTCTTATCAGCAGATGGTAATCAAGAAGGAAGCTGACTATGAAAACAATGTATTGTCGTTTAATCTTCAGA
CCTCAGACATTATGCCGGCTTTCACATATATTGCCCCCTTCTCTTCTATGGTACCTGATGTTTGCCGCATCATCAGGTCA
TACATAAAAGGATCTGTTGATTACTTGTCCTATGGAGTGAACACTAATTTCTTCAGTGTTCTGAGGAAGTACCTCGACAA
AATCTTGATTGATGTATTGAATGAAGTTATCCTCGAGACGATTAGCAACAATTCAATTGGTGTATCTCAAGCTATGCAGA
TTGCAGCAAACATATCTTTCCTCGAAAAGGCCAGTGACTATTTTCTACGGCATGCTGCTCAACTTTGTGGAATCCCAAGC
CGATCAGTTGAGAGGCCTCAAGCCAGTTTAGCTGCAAAGGTTGTCCTCAAAACATCTAGAGATGCAGCATATCTTGCTTT
GTTGAATGTGGTTAACACCAAGTTGGACGAGTTCATGAAGCTCACAGAAAACGTTAACTGGACTACAGAGGAAATGCCAC
AAGGGCCGCACGAGTACATGAACGAGGTTGTTATATACCTTGAGACTGTTATGTCGACGGCACAACAGATCCTCCCAATG
GATGCTTTATACAAAGTTGGGGTTGGAGCGATCGAGCATATTTCAAACTCCATCGTCTCTACATTCCTCAGCGATAGCAT
CAAGAGATTCAATGCTAATGCAGTCTCGGCCATTAACCATGACCTAAGAGTGATAGAAAACTTTGCTGACGAGAGATATC
ACTCAAGTGGGTTAAACGAGATCTACAAAGAAGGAAGCTTTAGAAGCTATCTGGTTGAAGCTAGGCAGCTGATAAACCTG
TTGTCGAGTAGCCAACCTGAAAACTTCATGAATCCAGTGATTAGAGAGAGGAACTACAACACTTTGGATTACAAGAAAGT
GGCTACAATCTGCGAGAAGTTTAAGGATTCTCCAGACGGGATATTCGGAAGCCTGGCAAATAGAAACACAAAGCTGACAG
CTAAAAAGAAATCCATGGATATGCTCAAGAAGAGACTCAAGGAATTTAACTGA