Details for Capsella Locus Carubv10019098m

Position : scaf_5 ( 5`- 11164623 .. 11165384 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10019098m

Protein [Map View]
MGNRCASTPSCRKLWSCICCCSNNNNNKTQTRIQHGSRGKVHPVSKIEKWEEKITEANKNGKILVVNFSAPWCVPCKKIE
PVFKELASRYPSMIFVTVDVEELAEFSNEWNVEATPTVVFLKDGRQMDKLVGAETSELQKKTAAAADLFLKKP*

DNA
ATGGGAAATCGTTGTGCAAGCACTCCTAGTTGTAGAAAGTTATGGTCATGTATATGCTGCTGCAGCAACAACAACAACAA
CAAGACTCAAACCCGAATCCAACACGGGTCCAGAGGCAAGGTCCATCCAGTAAGCAAAATCGAGAAATGGGAAGAAAAGA
TCACAGAAGCTAACAAGAATGGCAAGATTCTCGTGGTAAATTTCAGCGCGCCATGGTGTGTACCTTGTAAAAAGATAGAA
CCAGTATTCAAGGAGCTTGCTTCTAGATACCCTTCAATGATATTTGTAACCGTCGATGTCGAAGAACTCGCTGAGTTTAG
TAATGAGTGGAATGTGGAAGCTACACCAACGGTAGTGTTCCTTAAAGATGGAAGACAAATGGATAAACTTGTTGGTGCAG
AAACCTCAGAGCTTCAGAAGAAGACAGCAGCAGCTGCAGATCTCTTTCTCAAGAAACCATAA