Details for Capsella Locus Carubv10018949m

Position : scaf_5 ( 5`- 11235593 .. 11237468 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018949m

Protein [Map View]
MDAALPENAVVAGGAVMGDYGFSVDPFLVEALQNPRHRLTILRMELDVQRFLQNPEQQQFEFQHFPTSYLRLAAHRVANH
YGLVTAVQDSGADGNENRILVTKTTESKFPAVRLSEIPVAKPSENGKFERMKVSIKTRTSNGSGTGELEKKCGPFRSVEE
RKEEYDRARERIFSGLNCDDSSSESPVYGRNASLNKDDKQESKNAYVEVERNLSLRESGPTSRVAIFRDREKDRFDPDYD
RRHDRYIRSLPVNQNFNLPPFNIQQMPTPYYEMGFTGYNQIPSTPAFLGFRPPSSSITSPYGTTILNHASRDAMYMQWPN
AAMLYAHPYEQFMNASLQPQFCSQQPMSFDYMRNL*

DNA
ATGGACGCCGCGTTGCCGGAAAACGCCGTGGTAGCCGGTGGTGCGGTTATGGGAGATTATGGGTTTAGTGTGGATCCTTT
TTTGGTTGAGGCTTTGCAGAACCCTCGCCATCGTCTCACGATTCTGCGGATGGAACTTGATGTTCAAAGGTTCTTGCAGA
ACCCTGAACAGCAGCAGTTTGAGTTCCAGCATTTTCCTACCTCGTATCTTCGTCTTGCTGCCCATCGTGTTGCTAACCAC
TATGGACTAGTCACAGCGGTTCAAGACAGTGGTGCAGATGGTAATGAAAACAGAATCCTTGTGACCAAAACAACAGAGAG
CAAGTTTCCTGCTGTTCGGTTGTCTGAAATCCCAGTGGCTAAACCATCAGAAAATGGTAAATTTGAGCGCATGAAAGTTT
CAATCAAGACTCGAACTTCTAATGGATCTGGCACTGGTGAACTAGAAAAAAAATGTGGTCCTTTTAGAAGTGTTGAAGAG
AGGAAAGAAGAATATGACAGGGCTCGAGAACGGATATTTAGTGGTCTTAATTGTGATGACTCTTCATCTGAAAGTCCGGT
GTATGGGAGGAATGCAAGTCTTAACAAAGATGACAAGCAAGAATCTAAGAATGCTTACGTTGAGGTTGAGAGGAACTTAA
GCCTCAGAGAAAGTGGTCCAACATCTCGCGTTGCAATATTTAGAGACAGAGAGAAAGATCGGTTTGACCCTGATTATGAC
CGAAGACACGATAGGTACATTAGGAGCCTTCCGGTGAATCAGAATTTCAATTTACCACCCTTCAACATTCAGCAAATGCC
TACACCATACTACGAAATGGGATTCACTGGATACAACCAAATTCCAAGTACTCCTGCTTTTCTTGGCTTCAGGCCACCTT
CAAGCTCTATCACAAGTCCCTATGGCACCACAATTTTAAACCATGCTTCAAGGGATGCAATGTATATGCAGTGGCCCAAT
GCAGCTATGCTGTATGCTCATCCGTATGAACAGTTCATGAATGCTTCTCTTCAGCCACAGTTCTGCAGTCAACAACCAAT
GAGCTTCGACTACATGCGGAACCTGTAG