Details for Capsella Locus Carubv10018924m

Position : scaf_5 ( 5`- 11127381 .. 11129841 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018924m

Protein [Map View]
MGDIQERLSVSSSSSSSSSSLSLSTAQPKGVSLPIDGDSWRIAEERAHEILCTIQPVVISDRSRNEIIDYVRTLIKSHDG
IEVFSFGSVPLKTYLPDGDIDLTVLTNQNMDDDFYGQLCNKLQNEDSKSEFHATDVQFIPAQVKVIKCNIRSIAVDISFN
QTAGLCALCFLEQVDQLFGRDHLFKRSIILVKAWCYYESRILGANTGLISTYALAVLVLHIINLFHSSLSGPLAVLYKFL
DYYGSFDWSNFCISVSGPVPISSLPELMAVSPENEHDLLLDEKFLRNCVELYSAPTKAVEGNGLEFPVKPLNIIDPLKHS
NNLGKSVTQGNVQRLRHAFTHGARKLRDVLALPGEIMGWRLERFFRNSLERNGKGQRQDVIDPVTAFGTGRSELSELSGD
FEGYFGRLVYGQMYHGYSIPGTFQQSYIPVTSQVKDQNGWDIVRHLVSCRKNEFSLRGLNVSTSVQPFPLHSLNNGFQNM
RKRRGTGTFIPDMSQQLYSDRSRDPGTGNTLTNRLATSAEAINDEGASSCCNFSGEVSTYCTGNKGEECVRPGDCTDPDQ
PVLKSPRCVNLEIDENCQSPPPENLVDAISSSTLVLENGKEEYSRS*

DNA
ATGGGTGACATTCAAGAAAGATTGTCAGTTTCATCGTCTTCGTCTTCCTCGTCATCCTCATTGTCACTATCAACAGCACA
ACCTAAAGGGGTTTCATTGCCAATAGATGGGGATTCTTGGAGGATTGCAGAGGAGAGAGCTCATGAGATACTTTGCACTA
TCCAACCTGTCGTTATTTCAGACAGAAGTAGGAATGAGATCATTGATTATGTACGAACTCTAATCAAGAGTCATGATGGA
ATTGAGGTCTTTTCATTTGGCTCAGTGCCACTTAAAACATATCTCCCAGATGGAGATATTGATTTGACGGTCCTAACTAA
CCAAAATATGGATGACGATTTTTATGGACAATTGTGCAATAAGCTTCAAAATGAAGACAGTAAATCTGAATTCCATGCAA
CAGATGTTCAATTTATCCCTGCGCAGGTCAAGGTCATAAAGTGCAATATCAGGAGCATTGCTGTGGATATCTCTTTTAAT
CAAACGGCAGGTCTCTGTGCTTTATGTTTTCTGGAACAGGTTGACCAACTCTTTGGGAGAGATCATCTTTTCAAGCGTAG
CATCATCTTAGTTAAAGCTTGGTGCTACTACGAGAGTCGAATTCTTGGTGCAAACACTGGATTGATCTCAACATATGCAT
TAGCAGTACTGGTCTTGCACATCATCAACCTATTCCATTCATCATTATCTGGCCCTTTAGCGGTTCTGTATAAGTTCTTG
GACTATTATGGTTCATTTGATTGGAGCAACTTCTGTATCAGTGTCAGTGGCCCTGTGCCAATATCCTCCCTTCCTGAACT
TATGGCAGTTTCTCCAGAAAATGAGCATGACTTATTGCTTGACGAGAAGTTCTTAAGAAACTGTGTAGAGTTATACTCTG
CTCCAACTAAAGCTGTTGAAGGGAATGGTCTTGAATTTCCTGTCAAACCTCTCAATATAATTGATCCTCTAAAACACAGC
AACAACCTTGGAAAAAGTGTTACACAAGGAAATGTCCAACGATTAAGACATGCTTTTACCCATGGTGCTCGAAAGCTCAG
AGATGTTCTTGCACTACCTGGTGAAATCATGGGATGGAGACTGGAGAGATTCTTTCGTAACTCTTTGGAGAGGAATGGTA
AGGGTCAAAGGCAAGATGTAATTGATCCCGTTACTGCATTTGGTACTGGAAGATCAGAATTATCTGAACTTAGTGGAGAT
TTCGAAGGTTACTTTGGAAGACTTGTGTATGGGCAAATGTATCATGGCTATAGCATACCTGGAACTTTTCAGCAGAGCTA
TATCCCTGTGACTTCTCAAGTTAAGGACCAGAATGGTTGGGATATCGTTCGTCACCTTGTGAGTTGTCGAAAGAACGAGT
TTTCTTTGAGAGGTCTCAATGTATCAACCTCAGTGCAGCCTTTTCCTCTGCACTCTTTAAATAATGGCTTTCAAAACATG
AGAAAGAGGAGAGGAACTGGCACTTTTATTCCTGACATGAGTCAACAGTTATACTCCGACAGGTCCAGAGACCCGGGTAC
GGGTAACACATTGACTAATCGTTTAGCAACTTCCGCTGAGGCAATTAATGATGAGGGAGCCAGTAGTTGCTGCAATTTTT
CTGGTGAAGTGTCTACTTACTGTACTGGTAACAAGGGAGAAGAATGTGTGAGACCAGGGGATTGCACTGACCCAGATCAG
CCTGTGCTGAAATCTCCAAGATGCGTGAATCTGGAGATAGATGAAAATTGCCAATCTCCACCACCAGAGAACCTAGTAGA
TGCCATATCTTCAAGCACATTGGTACTGGAAAATGGGAAAGAAGAGTACAGCAGATCATAA