Details for Capsella Locus Carubv10018864m

Position : scaf_5 ( 5`- 11081538 .. 11082326 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018864m

Protein [Map View]
MPKNKKTEWQVGDPTISVVSDQFCNPYPMDLLVKRKVQNFSKDHYEVFDPSGNLLLQVDGQAWGFNRKRTMRDPAGFTIL
TMRQKGLALKTKWEVHGGESKEREDLLFTVQQSQAVSLKTSVDVFLPENNNVKKTNTCDFHASGGYSNISFKVFKSDALI
AGVGFTWGSFCKGKYNFKVRVHPEVDYAFIIALLVMVDDNENWC*

DNA
ATGCCGAAGAATAAGAAAACAGAATGGCAAGTAGGAGATCCCACGATAAGCGTAGTGAGCGATCAATTCTGTAATCCATA
CCCTATGGATCTATTGGTGAAGAGGAAAGTTCAGAATTTCTCCAAAGATCATTATGAAGTGTTTGATCCAAGCGGTAATC
TGCTCCTACAAGTTGATGGACAAGCTTGGGGGTTTAACCGTAAAAGAACTATGCGTGATCCAGCCGGTTTCACAATCCTC
ACAATGCGCCAAAAGGGTCTTGCGTTGAAGACTAAGTGGGAAGTGCATGGAGGAGAGAGCAAAGAGAGAGAAGACTTGCT
CTTCACGGTACAACAATCTCAAGCGGTCTCATTGAAAACGTCTGTGGATGTTTTCTTGCCCGAGAACAACAATGTCAAGA
AGACCAACACTTGTGATTTTCATGCTTCAGGAGGATACTCTAATATCTCATTCAAAGTTTTCAAATCGGATGCTCTCATC
GCGGGGGTAGGGTTTACATGGGGAAGTTTCTGCAAAGGGAAATATAATTTCAAGGTGAGAGTACATCCAGAGGTTGACTA
TGCTTTTATCATTGCTTTGCTTGTTATGGTCGATGACAACGAGAATTGGTGTTAG