Details for Capsella Locus Carubv10018600m

Position : scaf_5 ( 5`- 11065979 .. 11070034 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018600m

Protein [Map View]
MAIASILTSTQNPFLCLREPTPLGTRSVVFRRYREPCGRRWIPRSIRACQPSDKLGGDGGISPSAKRLHFGKELLTFASD
NFLPLALVSGVGLGFANPTLGCLADKYSFTKISTCGIFIISGLTLRTEAIGAAVKGWPLGVFGLISILLLTPSFSRLIML
FQLQPPELVTGLAIFCCMPTTLSSGVALTHLAGGNAALALAVTVASNLLGILSIPFWVSRYIAGGVGVSFPTEQLFRSLV
VTLLIPLIIGKVIRESFKGFANFVDNNRNLFSKINAICLSMVPWIQVSRSRSLLLSVKPKVFLAAVGIGILLHLSLLAFN
AVSIGILSGVSGGSKNSKENGTAVLLVSSQKTLPVMVAVVEQLGGAFGETGLLVLPCVAAHLNQIMIDSILVNLWLRKGK
DTSTDVKTA*

DNA
ATGGCGATAGCTAGTATCCTGACTTCAACCCAAAACCCCTTTTTATGTCTCCGGGAACCAACGCCTCTTGGGACCCGCTC
CGTCGTCTTCCGCCGCTATCGAGAGCCCTGTGGCAGACGATGGATTCCCAGATCCATTAGAGCTTGCCAACCGTCCGACA
AGCTTGGTGGTGATGGAGGCATTTCACCTTCAGCTAAAAGATTACATTTTGGGAAGGAACTGCTGACTTTTGCTTCAGAT
AATTTCTTGCCTCTAGCTCTTGTTAGTGGAGTGGGGCTGGGCTTTGCAAATCCAACTCTAGGCTGTCTTGCAGACAAATA
CTCTTTCACTAAGATCAGCACATGCGGAATATTTATTATATCAGGATTGACTTTACGTACTGAAGCGATTGGTGCTGCTG
TTAAAGGATGGCCTCTTGGAGTCTTCGGGCTAATCTCTATTTTGTTGCTCACTCCATCCTTCTCACGGCTAATTATGCTG
TTCCAACTTCAACCCCCGGAACTTGTTACAGGGCTGGCTATATTTTGCTGTATGCCAACCACCTTATCAAGTGGTGTTGC
CCTTACTCACCTTGCTGGTGGCAATGCTGCTCTTGCGCTTGCGGTGACTGTGGCATCAAACTTATTAGGAATTTTAAGTA
TTCCATTTTGGGTATCGAGATACATAGCTGGGGGAGTAGGTGTTTCTTTTCCAACTGAGCAATTGTTCAGAAGTCTTGTA
GTTACTCTGTTAATTCCTTTAATCATTGGCAAGGTTATTCGGGAATCATTCAAAGGGTTTGCAAACTTTGTTGACAATAA
CCGTAATCTATTTTCAAAGATCAACGCAATCTGCCTCAGTATGGTACCATGGATCCAAGTTAGCAGGTCAAGATCACTGC
TGTTATCCGTTAAGCCTAAGGTTTTTCTTGCTGCCGTTGGCATTGGAATATTGCTGCATCTTTCTCTATTAGCATTCAAT
GCTGTTTCGATCGGCATCCTCTCAGGTGTTTCAGGTGGTAGCAAGAACTCAAAGGAAAATGGCACTGCAGTCTTGCTCGT
TTCAAGTCAGAAAACACTACCGGTAATGGTGGCGGTAGTGGAGCAATTGGGAGGTGCATTTGGTGAGACAGGGCTCTTGG
TTCTTCCTTGTGTAGCTGCACACCTGAACCAGATCATGATTGATTCAATTCTTGTCAACTTATGGCTCCGGAAGGGTAAA
GATACTTCGACTGATGTAAAGACAGCCTGA