Details for Capsella Locus Carubv10018571m

Position : scaf_5 ( 5`- 11173958 .. 11175193 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018571m

Protein [Map View]
MGRSKLGSSNKKKKNKKKKSKVGREKDQTFSDLPSDLLKLVISLLPLKDNILASAVCKSWHKVCVSLRAVDTSPWLIYFP
KTDESYELYDPSMEKTHSLQFPELSGFRVCSSKDGWLLMYNANTYQLFFFNPFTRNCIPVPPLWMAYDQRMAFSCDPTST
NCVLFTVSYVTWSYITIKTCCAYATEWNTFVFKNRLPRNFNIFEQIVFSNGAFYCLTNTGCLSLFDPSLNSWNILPGRPS
KRPGSNRCFMTEHQGEIFLIYMYRHMNPTLLKLDITSSTWTERKTLGGLTIYASALSSESRAEQQKPSGIRNCLCLSVFH
GFKRTCISYKVDEESKICLKWKNHDPYENIWIMPPQNLLDLPLFDQHL*

DNA
ATGGGAAGGTCGAAGCTTGGATCGTCGAACAAAAAGAAGAAGAATAAGAAGAAGAAGAGTAAGGTGGGAAGAGAAAAGGA
CCAAACTTTCTCAGACCTTCCTTCTGATCTCTTAAAACTGGTAATTTCTCTTCTTCCTTTGAAAGACAACATCCTTGCTT
CCGCTGTCTGCAAATCATGGCACAAAGTTTGTGTTTCTCTTCGAGCGGTTGATACCTCTCCTTGGCTTATCTACTTTCCC
AAAACAGACGAATCCTATGAACTTTATGACCCATCAATGGAGAAAACTCACAGTCTTCAGTTTCCTGAGTTATCAGGTTT
TCGGGTTTGTTCCTCCAAAGATGGTTGGTTACTCATGTACAATGCCAATACTTATCAGCTCTTTTTCTTCAATCCGTTTA
CTCGAAATTGCATACCTGTGCCTCCGCTTTGGATGGCATATGATCAAAGAATGGCTTTCTCTTGTGATCCTACATCAACT
AATTGTGTCTTGTTCACAGTCAGCTATGTCACTTGGAGTTACATCACCATCAAGACATGTTGTGCTTATGCCACAGAGTG
GAACACATTTGTGTTCAAGAATCGGCTGCCACGAAACTTCAACATTTTCGAGCAGATTGTCTTCTCCAATGGCGCCTTCT
ACTGCCTCACTAATACAGGATGTTTATCGCTCTTCGACCCGTCTTTGAATTCTTGGAATATTCTTCCCGGGCGACCTTCG
AAACGTCCGGGAAGCAACAGATGCTTTATGACAGAACACCAGGGAGAGATCTTTCTCATTTACATGTACAGACACATGAA
CCCAACCTTGCTTAAACTTGACATTACAAGCTCTACATGGACTGAGAGGAAAACACTGGGAGGCTTGACAATCTACGCAA
GCGCCTTGTCTTCTGAATCGAGAGCCGAGCAGCAGAAGCCGAGTGGAATTAGAAACTGTTTGTGTCTCTCTGTGTTCCAT
GGATTCAAGAGGACTTGCATATCTTACAAGGTTGATGAAGAGAGTAAGATTTGCTTGAAATGGAAAAACCATGATCCGTA
TGAGAATATCTGGATCATGCCACCTCAAAATCTCCTTGATCTCCCTTTGTTTGATCAACATCTCTAG