Details for Capsella Locus Carubv10018370m

Position : scaf_5 ( 5`- 11124017 .. 11126901 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018370m

Protein [Map View]
MAIVNKMKDSVLFLVWLFSLSVLVSQSIAGRVKAPLLQSNPGGLVFSKSFNSIYDTSMYGRLQLNNGLARTPQMGWNSWN
FFACNINETVIKETADALVSSGLADLGYIHVNIGIKLLADYVHSKGLKLGIYSDAGIFTCQVRPGSLYHEVDDADIFASW
GVDYLKYDNCFNLGIKPIKRYPPMRDALNATGRSIFYSLCEWGVDDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNK
WAAYAGPGGWNDPDMLEVGNGGMTYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAINQDPLGVQGRKIQ
ANGDDNCQQVWSGPLTGDRMVIALWNRCSEPATITASWDLIGLESTISVSVRDLWQHKDVTDNASVSFEAQVDAHDCHMY
VLTPQTESHSDV*

DNA
ATGGCGATTGTCAATAAGATGAAAGATTCAGTCTTGTTCCTCGTTTGGCTCTTCTCCTTATCGGTTTTGGTCTCCCAATC
GATCGCAGGGAGAGTCAAAGCTCCATTGTTACAGAGCAATCCTGGTGGATTAGTTTTCAGCAAATCATTCAATTCGATCT
ATGATACTTCTATGTACGGACGCTTGCAGCTCAACAATGGCCTCGCTCGAACTCCACAAATGGGATGGAATAGCTGGAAT
TTCTTTGCTTGCAATATCAATGAAACAGTTATTAAGGAAACTGCTGATGCTTTGGTCTCCTCTGGCTTGGCTGATTTAGG
ATATATACATGTCAATATTGGAATTAAGCTTCTTGCTGATTATGTTCATTCAAAAGGTCTCAAACTCGGTATATATTCTG
ATGCTGGCATTTTCACGTGTCAAGTTCGTCCTGGATCTCTTTACCATGAAGTGGATGATGCAGACATTTTTGCTTCTTGG
GGTGTAGATTATCTGAAATATGACAATTGTTTCAACCTGGGAATAAAACCAATCAAAAGATACCCTCCCATGCGTGATGC
TCTAAACGCGACTGGTCGCTCAATTTTCTATTCGCTCTGTGAATGGGGTGTTGATGATCCTGCCTTGTGGGCAAAAGAAG
TTGGAAACAGTTGGCGCACAACTGATGACATCAATGATACATGGGCAAGTATGACTACAATTGCTGATTTGAATAACAAG
TGGGCTGCTTATGCTGGACCTGGTGGTTGGAATGATCCGGATATGTTGGAAGTTGGGAATGGAGGGATGACGTACGAGGA
GTACCGAGGTCATTTTAGCATTTGGGCTTTGATGAAGGCACCACTTTTGATTGGTTGTGATGTAAGAAACATGACCGCAG
AAACTTTTGAGATTTTGAGCAATAAGGAAGTTATCGCTATAAACCAAGACCCACTTGGTGTTCAAGGTAGGAAAATTCAA
GCCAATGGAGATGATAACTGTCAGCAGGTGTGGTCAGGACCTTTAACTGGTGACCGTATGGTAATCGCTCTCTGGAACCG
TTGCTCTGAGCCTGCAACCATTACAGCATCATGGGATCTAATCGGTCTTGAATCTACTATTAGCGTCTCAGTAAGAGACT
TGTGGCAACACAAAGATGTAACAGATAATGCTTCTGTTTCATTTGAAGCTCAAGTAGACGCACACGACTGTCATATGTAC
GTTCTCACTCCCCAGACAGAATCACACTCTGATGTATAG