Details for Capsella Locus Carubv10018237m

Position : scaf_5 ( 5`- 11133499 .. 11134944 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018237m

Protein [Map View]
MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYDGYALPKLYAKMQYCVSCAIH
SHVVRVRSTTNRRIRTPPPRFARRKEDTPKPGQPGQAPRPAGGAPAAPRA*

DNA
ATGACATTCAAGCGTAGAAATGGTGGCAGGAACAAGCATAACCGTGGTCATGTGAACCCAATCAGGTGTTCCAACTGTGG
AAAGTGTTGCCCCAAGGATAAGGCGATCAAGAGATTCATCGTAAGGAACATTGTTGAGCAAGCTGCTATCAGGGATGTTC
AAGAGGCCAGCGTCTACGATGGTTACGCTCTACCAAAGCTTTACGCTAAGATGCAATACTGTGTCTCATGTGCCATCCAC
TCTCACGTTGTGAGAGTCCGATCCACCACCAACCGTAGGATTCGTACCCCACCACCTCGGTTTGCCAGACGCAAGGAGGA
TACACCCAAGCCTGGACAACCTGGTCAGGCTCCTCGCCCTGCCGGTGGTGCACCTGCTGCTCCTCGTGCTTGA