Details for Capsella Locus Carubv10018165m

Position : scaf_5 ( 5`- 11096045 .. 11097407 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018165m

Protein [Map View]
MVSREHKRGSSLREKIHLLRSITNSHAESETSIIMDASKYIKKLKQKVEKINNGTSSEQSFRDPSDSNPTVTVETLEKGF
MIEVMSGKNEAGMLVCVLETFEDLGLDVVEARVSCTDTFSLHAIGSSDNDDGDRMDAEAVKQAVAEAIRTWSDSHHA*

DNA
ATGGTTTCGAGAGAACACAAGAGAGGTTCATCTCTTCGTGAGAAGATTCATTTGCTTCGTTCAATCACTAATTCTCATGC
TGAGAGTGAAACATCGATCATAATGGATGCATCAAAATATATCAAAAAGCTTAAGCAAAAAGTCGAAAAAATCAACAATG
GGACCTCATCCGAGCAATCATTCCGCGACCCTTCCGATTCAAACCCTACGGTTACAGTGGAAACCCTAGAGAAGGGGTTC
ATGATAGAGGTAATGTCAGGGAAGAATGAGGCAGGGATGTTGGTTTGTGTTCTTGAAACCTTCGAAGATCTTGGACTTGA
TGTTGTTGAAGCTAGGGTTTCATGTACAGACACATTTAGCTTACATGCCATTGGTTCATCAGATAATGATGATGGAGACA
GGATGGATGCTGAAGCAGTGAAACAGGCAGTGGCAGAAGCGATCAGGACCTGGAGTGATAGTCATCATGCATGA