Details for Capsella Locus Carubv10018107m

Position : scaf_5 ( 5`- 11119484 .. 11120670 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018107m

Protein [Map View]
MGFRALPLHHNSGFVSTTRVPASRISPRFSRSPRWVVVSAKQDKDDEKKSKNEDETSLFTKLTDALDFSQVRSEKDAELL
YEAREATKSGGKMTQEQYGALRRKIGGTYKDFFKSYVEVDGQYVEEGWVDKTCKICKKDTKGEARQVDKLGRYVHVSCLQ
NPPSSSGNFFTRLFSR*

DNA
ATGGGTTTTAGAGCTCTGCCTCTTCACCACAACAGCGGCTTCGTCTCCACCACCAGAGTCCCGGCCTCAAGAATATCGCC
GAGATTTAGCCGGAGCCCTAGATGGGTCGTTGTGTCGGCGAAGCAGGATAAAGATGATGAGAAGAAGTCGAAGAATGAAG
ATGAGACTTCGTTGTTTACTAAATTAACAGATGCTTTGGACTTCTCACAGGTTCGGTCGGAGAAAGACGCTGAGCTTCTC
TACGAGGCTCGTGAAGCCACCAAATCTGGTGGCAAGATGACCCAAGAACAGTATGGGGCATTGAGGAGAAAAATCGGAGG
CACATACAAGGACTTTTTTAAATCCTACGTTGAAGTGGATGGGCAATATGTGGAGGAAGGATGGGTGGACAAAACATGCA
AGATTTGCAAAAAGGACACAAAGGGTGAGGCAAGACAAGTTGACAAGTTAGGGAGATATGTTCATGTCTCTTGTCTTCAA
AATCCTCCCAGTTCTTCTGGAAATTTCTTCACAAGGCTCTTCTCTAGATGA