Details for Capsella Locus Carubv10018096m

Position : scaf_5 ( 5`- 11100690 .. 11101988 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10018096m

Protein [Map View]
LISQCSRFLYANSSSESLFCFCVTIYSQEGTISFHSTNEHLILQFGSSISKLYRIRFISIILVIMTQTVVLKVGMSCQGC
VGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKKTSFWPVEAEAEPKTEADEAVTETKTEAETKSEA
PKVDVEPKVAAEAAETKPSQV*

DNA
CTAATTTCACAATGCTCTCGTTTCCTTTACGCTAACTCCTCTTCCGAATCTCTTTTTTGCTTTTGCGTTACTATATATAG
TCAAGAAGGCACCATTTCTTTTCATTCAACAAACGAACATCTCATTCTCCAATTCGGATCATCGATCTCAAAGCTTTATC
GAATTCGTTTCATCTCAATTATTCTAGTGATCATGACTCAGACCGTTGTCCTCAAAGTCGGTATGTCATGCCAAGGCTGC
GTTGGTGCCGTCAATAGAGTCTTGGGCAAAATGGAAGGGGTTGAGTCATTTGACATTGATATCAAGGAGCAAAAGGTGAC
AGTGAAAGGTAATGTTGAGCCTGAAGCAGTTTTCCAAACAGTCTCAAAGACCGGAAAGAAGACCTCTTTCTGGCCAGTCG
AGGCTGAGGCTGAGCCCAAAACCGAGGCTGATGAGGCCGTGACTGAGACCAAAACCGAGGCTGAGACTAAGAGTGAGGCG
CCTAAGGTTGATGTTGAACCAAAAGTGGCAGCAGAAGCAGCCGAGACTAAGCCATCACAAGTTTAA