Details for Capsella Locus Carubv10017975m

Position : scaf_5 ( 5`- 11103589 .. 11106568 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017975m

Protein [Map View]
MNIPTRRSPGKLTEAPRSVGGRIQRKPLADCTNIVSRSSQQSSSSVKFANPSLTSSLKRLVDQTKIKETQKPKDVITSEA
ASPSPAPATKVRPVTRRMSADLASPASAPSRPQTSRTELGVSDKEFAEPWSVYTVRRKRNKRTSSSSSAVARMPLDLTSS
SGKKTWQANVKTKPLKVAPKKRQRTVKQENENSVHAASRDYIEKQKAYFAEIDAFELPVEDASSGDSD*

DNA
ATGAATATTCCGACGCGAAGATCACCGGGTAAATTAACGGAAGCTCCTCGCTCCGTCGGTGGAAGAATTCAGAGGAAACC
GCTTGCGGATTGTACCAATATCGTCTCCAGATCTTCTCAACAGTCATCTTCTTCAGTCAAATTCGCGAATCCTAGTCTCA
CTTCTTCTCTTAAGAGGTTAGTTGATCAAACGAAGATCAAGGAGACACAGAAACCCAAAGATGTTATTACTTCTGAGGCC
GCTTCTCCGTCTCCTGCTCCTGCCACGAAGGTTAGACCCGTCACTCGCCGTATGTCCGCCGATCTCGCTTCTCCGGCCTC
TGCTCCTTCTCGTCCTCAAACATCGCGCACTGAATTGGGCGTTAGTGACAAGGAGTTTGCAGAGCCTTGGTCTGTATACA
CGGTGAGAAGGAAAAGGAATAAACGCACATCTTCTTCCTCTAGTGCAGTGGCTCGCATGCCTCTGGACTTGACATCAAGC
TCCGGGAAGAAAACATGGCAAGCAAATGTAAAAACGAAGCCCTTGAAAGTAGCTCCTAAAAAGAGGCAACGGACGGTAAA
GCAAGAGAACGAGAATTCGGTTCATGCAGCTTCTCGTGATTATATCGAGAAGCAGAAAGCATACTTTGCAGAGATCGATG
CATTTGAGCTGCCAGTAGAAGATGCATCTAGTGGCGACTCAGACTAA