Details for Capsella Locus Carubv10017945m

Position : scaf_5 ( 5`- 11135192 .. 11136754 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017945m

Protein [Map View]
MTTVVFIILLAIFATSLYGAGGTTMDPCLESMKTASLPDLPYAYDALEPAISEEIMRLHHQKHHQTYVTQYNKALNSLRS
AMADGDHSSVVKLQSLIKFNGGGHVNHAIFWKNLAPVHEGGGKPPHDPLSSAIDAHFGSLEGLIQKMNAEGTAVQGSGWV
WLGLDRELKRLVVETTANQDPLVTKGTHFVPLIGIDVWEHAYYPQYKNARAEYLKNIWSVINWKYAADVFEKHSRDLDTN
*

DNA
ATGACCACCGTCGTCTTCATAATCTTACTTGCGATATTCGCTACGAGTCTTTACGGCGCCGGAGGAACAACCATGGACCC
GTGTCTCGAGTCAATGAAGACCGCCTCACTGCCTGATCTTCCGTATGCCTATGATGCACTAGAACCAGCTATAAGCGAGG
AGATCATGCGGCTCCATCACCAGAAACACCACCAGACTTATGTCACTCAGTACAACAAAGCCCTCAACAGCCTTCGCTCT
GCCATGGCCGACGGTGATCACTCCTCTGTCGTCAAACTCCAAAGCCTCATCAAGTTCAACGGAGGAGGTCACGTTAACCA
TGCAATATTCTGGAAGAACCTTGCTCCTGTTCATGAAGGAGGTGGGAAGCCACCGCACGATCCTTTGTCTTCGGCGATTG
ATGCTCATTTCGGATCCTTAGAGGGATTGATCCAAAAGATGAACGCGGAAGGCACTGCTGTGCAGGGGTCTGGATGGGTG
TGGCTTGGGTTAGACAGAGAGCTAAAGAGACTTGTCGTTGAGACCACCGCCAATCAGGATCCATTGGTGACTAAAGGAAC
ACACTTTGTTCCTCTAATCGGGATTGACGTGTGGGAGCATGCCTACTACCCACAGTACAAGAATGCAAGAGCGGAGTACT
TGAAGAACATATGGAGTGTGATCAACTGGAAATACGCCGCGGACGTATTCGAGAAGCATAGCCGTGATCTTGATACAAAC
TGA