Details for Capsella Locus Carubv10017866m

Position : scaf_5 ( 5`- 11230099 .. 11232075 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017866m

Protein [Map View]
MATASLVPTSKIFSSSTKCPASNKVRTGVAVASLQQQPRRRELLLKSAVAIPAILQLKEAPISEAREVEVGSFLPPSPSD
PSFVLFKAKPSDTPALRAGNVQPYQFVLPPNWKQLRIANILSGNYCQPKCAEPWIEVKFENEKQGKVQVVASPLIRLTNK
PNATIEDLGEPEKVIASLGPFVTGNSYDSDELVDTSIEKIGDQTYYKYVLETPFALTGSHNLAKATAKGNTVVLFVVSAT
EKQWQSSQKTLQAILDSFQL*

DNA
ATGGCGACTGCGTCTCTAGTTCCGACATCTAAAATCTTTTCGTCCTCTACGAAATGTCCAGCCTCGAATAAAGTAAGGAC
TGGCGTAGCTGTTGCATCGTTGCAACAACAACCAAGAAGAAGAGAGCTGCTGCTGAAATCTGCGGTGGCTATTCCGGCGA
TTCTGCAGTTGAAAGAAGCTCCGATATCGGAGGCGCGTGAGGTGGAAGTTGGATCATTCTTACCTCCATCTCCGTCTGAT
CCTTCCTTCGTCCTCTTCAAAGCCAAACCTTCTGATACTCCTGCTCTCCGCGCAGGAAATGTTCAGCCCTATCAGTTTGT
TCTACCGCCAAACTGGAAACAGTTGCGAATAGCCAACATTTTGTCAGGTAATTACTGCCAACCAAAATGTGCAGAGCCAT
GGATCGAAGTGAAGTTTGAGAATGAGAAGCAAGGCAAAGTTCAAGTAGTCGCATCTCCTTTGATCCGCTTAACCAACAAA
CCAAATGCAACCATTGAAGATCTTGGTGAGCCCGAGAAAGTGATTGCTTCTCTTGGTCCCTTTGTCACTGGAAACTCTTA
TGACTCTGATGAACTTGTTGACACTTCAATCGAAAAGATTGGAGATCAAACGTACTACAAGTATGTGTTGGAGACGCCAT
TTGCTCTCACAGGAAGTCACAATCTTGCAAAAGCGACAGCAAAAGGAAACACGGTGGTTCTGTTTGTTGTGAGTGCTACT
GAAAAGCAATGGCAGAGCTCACAGAAGACTCTTCAAGCCATTCTTGATTCTTTTCAACTGTAA