Details for Capsella Locus Carubv10017859m

Position : scaf_5 ( 5`- 11149025 .. 11150970 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017859m

Protein [Map View]
MEEIMTMIFNGINLVKELEFSLSSQELPESDLSNSLGSISTLFGDANERLKSQLAWKNSLAQLEPVRMMDMMMETEPALT
QQDHWIRYPVMQTVKGNDDTSRPRHRPRKKDIGGEETVLMAAMGRIEIPPDDNYTWRKYGQKEILGSRFPRAYYRCTHQK
LYKCPAKKQVQRLDEDPYTFRVTYRSSHTCHFFATSLTSSAHVHATTPAANVPAVVNLAETMIGNMDSVVPFGELPYFNH
HCLVPGDDANCEDTWNYDMSS*

DNA
ATGGAGGAGATAATGACAATGATCTTCAACGGAATCAATCTGGTTAAGGAGCTTGAGTTCAGCTTATCATCACAAGAGTT
GCCAGAATCAGATTTGTCTAACTCTCTCGGCTCGATCTCCACTTTATTCGGAGATGCAAACGAGCGGCTGAAAAGCCAAC
TAGCGTGGAAGAACTCTTTGGCACAGCTGGAACCGGTTCGAATGATGGATATGATGATGGAGACAGAACCGGCTTTGACG
CAGCAGGACCACTGGATAAGGTACCCTGTGATGCAGACGGTGAAGGGTAATGATGATACCTCGAGACCAAGGCATCGACC
AAGGAAGAAGGATATAGGAGGAGAAGAAACGGTGCTGATGGCGGCCATGGGGAGGATTGAGATCCCGCCGGACGACAATT
ACACTTGGCGTAAATACGGTCAGAAGGAGATTCTTGGTTCTAGGTTTCCTCGGGCGTACTATAGGTGCACCCACCAGAAA
CTATACAAGTGTCCGGCGAAGAAGCAAGTGCAACGGCTCGACGAAGATCCTTATACGTTCCGTGTCACTTACCGTAGTTC
ACACACTTGTCACTTCTTCGCCACTTCCCTGACCTCATCAGCACATGTGCATGCCACCACACCAGCCGCAAACGTTCCCG
CCGTCGTTAACTTGGCCGAAACTATGATTGGCAACATGGACTCCGTTGTTCCGTTTGGCGAACTTCCCTACTTTAACCAC
CATTGCCTCGTTCCTGGAGACGATGCTAATTGCGAAGACACGTGGAATTACGACATGTCCTCTTAG