Details for Capsella Locus Carubv10017788m

Position : scaf_5 ( 5`- 11097845 .. 11099087 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017788m

Protein [Map View]
MDCSICTTMPTILRPPRNTICGSCYEGAKTTIALLKKLEGSNEDDDKSTHESTINNGSSLSSSPLFSCEPQPLEKVIKWM
KNMKETEEEQKKRIVFLSSFVSGFKEQLHADILLRAGDDGPPIPAHRALLASKSEIFKNILDSDGCKTAPEYAITLQELN
SEQLQALLEFLYTGTLASDKLEKHVYALFVAADKYMIHYLQDLCEQHMLNSLDISSVLDVLDVSDLGSSKTLKEACLRFV
VRNMDDVVFSDKYEVFSQKNQHLCVQITRAFLMETRSKRSD*

DNA
ATGGATTGCTCAATCTGCACCACAATGCCAACTATTCTAAGACCACCAAGGAACACAATATGTGGATCTTGCTACGAAGG
TGCTAAAACCACTATCGCGCTGCTCAAGAAGCTCGAGGGCTCGAACGAAGATGATGACAAATCAACCCATGAGTCCACCA
TCAATAATGGCTCCTCTCTTTCTTCTTCTCCTTTGTTTTCTTGTGAGCCGCAACCACTAGAAAAGGTGATCAAATGGATG
AAAAACATGAAAGAAACCGAAGAAGAACAGAAGAAAAGGATAGTCTTCTTGAGCAGCTTTGTTTCGGGTTTCAAAGAACA
GCTTCATGCTGATATTCTTCTTAGAGCCGGCGACGATGGCCCTCCAATTCCTGCACATAGAGCTTTGCTGGCTTCGAAGT
CCGAGATCTTCAAGAACATTCTAGACTCAGACGGATGCAAAACTGCTCCAGAATACGCAATAACGCTCCAAGAACTAAAC
TCCGAGCAACTTCAAGCTCTCTTGGAGTTTCTATACACCGGCACATTGGCTTCAGACAAGTTGGAGAAACATGTATACGC
CTTGTTTGTTGCGGCGGATAAGTACATGATCCATTACTTGCAAGATTTGTGCGAGCAACATATGCTGAATTCCTTGGACA
TCTCTAGCGTTCTTGACGTTCTTGATGTCTCGGATCTTGGTTCGAGCAAGACGCTGAAGGAGGCTTGTCTAAGGTTCGTG
GTGCGGAACATGGACGACGTCGTTTTCTCGGATAAGTATGAAGTATTTTCTCAGAAAAACCAACATCTATGTGTGCAGAT
CACAAGAGCGTTCTTGATGGAAACGAGAAGCAAGAGAAGTGATTAA