Details for Capsella Locus Carubv10017753m

Position : scaf_5 ( 5`- 11187852 .. 11190293 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017753m

Protein [Map View]
YTHGLLLRRPNRVQVRRRHCLLLLPLLPYLVPLLKKMQSDQSHELATGMSEEDSKEKMKNQKADRKKKKLKEKLLKEASK
ADNRGVCYLSRIPPHMDHVRLRQILCQFGELGRIYLAPEDPEAQVHRKKAGGFRGQLFSEGWVEFAKKRVAKRVADMLNG
EQIGGKKKSSIYYDIWNIKYLTKFKWDDLTEEIAYKSAIREQKLNMVLSAAKREKDFYLSKVEKSRAMTEIDARMEKKRK
IQEESGSNAEAGPVFPQRVIRQFRQKKSIKNETSQSKPGLSTDVLASVFGGS*

DNA
TACACACATGGTCTTCTTCTTCGTCGTCCGAACAGAGTACAAGTTCGCCGACGTCACTGTCTTCTTCTTCTTCCTCTTCT
TCCTTACTTAGTTCCGCTGCTGAAGAAGATGCAGAGTGATCAATCTCACGAGCTTGCTACTGGAATGTCCGAGGAGGATT
CCAAGGAAAAAATGAAGAATCAAAAGGCTGATAGGAAGAAAAAGAAGTTGAAAGAGAAATTGCTTAAGGAAGCTTCTAAG
GCTGACAATAGAGGGGTTTGCTACTTAAGTCGCATCCCACCACACATGGATCATGTTAGACTTCGCCAGATTCTCTGTCA
ATTTGGAGAACTTGGAAGGATTTATCTTGCACCTGAAGATCCTGAAGCACAAGTGCATCGCAAGAAGGCTGGTGGATTTC
GGGGGCAATTGTTTTCTGAAGGGTGGGTGGAGTTTGCGAAGAAAAGAGTAGCTAAGCGGGTTGCAGATATGCTGAATGGA
GAACAAATTGGAGGAAAAAAGAAGTCATCGATATACTATGATATTTGGAACATCAAATACTTGACCAAATTTAAATGGGA
TGATCTCACTGAAGAAATCGCATACAAAAGTGCAATACGGGAACAGAAATTAAATATGGTACTTTCTGCTGCAAAGAGAG
AGAAGGACTTTTATCTTTCTAAAGTAGAGAAGTCGCGTGCCATGACCGAGATAGATGCACGAATGGAAAAGAAACGAAAG
ATTCAGGAAGAATCAGGTAGCAATGCTGAAGCAGGGCCAGTCTTTCCACAGAGGGTGATTCGCCAGTTTAGACAGAAGAA
ATCGATTAAAAATGAGACATCTCAGAGCAAGCCTGGGCTCTCCACGGATGTCCTAGCATCGGTATTCGGCGGTTCTTAA