Details for Capsella Locus Carubv10017685m

Position : scaf_5 ( 5`- 11212447 .. 11214682 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017685m

Protein [Map View]
MTFPIFMQIFVLALLGPLIDQNLYYAGLKLTSPTFAGAVTNIVPALTFIISIICRMEKVEMRKVRFQAKVVGTLVIVVGA
MLMILFRTPLFNFLRSHLSGDASLPAGEDYLKATVFLLIASFSWASFFVLQAATLKRYSSHLSLSTMVCFMGTLQSTALT
FVMEPNLSAWNIGFDMNLLASVYGGIITSGIAYYVQGIMTKQKSVVFVTAFNPLVVIIGSIIGFLILGQNLYLGGVLGMT
ILLVGVCAVLWGKEGDDEEGNIDDKFVEVVKCCCNGCEIKVLSMMMPRIDEEVDVEMQSPEKANVAVGFS*

DNA
ATGACATTTCCAATATTCATGCAGATTTTTGTTCTAGCTCTTCTTGGGCCTCTGATCGATCAAAACTTATATTACGCCGG
ACTCAAACTTACTTCACCAACTTTTGCCGGCGCCGTCACCAATATCGTTCCTGCTTTGACCTTTATCATTTCCATAATTT
GCAGGATGGAGAAGGTGGAGATGAGAAAAGTAAGATTCCAAGCAAAAGTGGTGGGGACGTTAGTGATAGTGGTTGGAGCC
ATGTTGATGATTTTATTCAGAACTCCTCTCTTCAACTTTCTCCGATCTCATCTCTCCGGCGATGCTTCGTTACCGGCCGG
TGAGGACTACCTCAAAGCCACCGTATTCCTCCTCATCGCCTCCTTTTCTTGGGCTTCCTTTTTTGTTCTTCAGGCGGCTA
CGTTGAAGAGATACTCATCTCACCTTTCATTATCGACGATGGTGTGCTTCATGGGAACGTTACAGTCGACAGCCTTAACG
TTTGTGATGGAGCCAAACCTTTCTGCATGGAACATTGGCTTTGACATGAACCTTCTCGCCTCTGTTTACGGGGGCATAAT
AACGTCTGGCATAGCATACTACGTTCAAGGAATAATGACGAAACAAAAGAGCGTTGTCTTTGTCACTGCTTTTAACCCCC
TTGTTGTCATAATTGGATCCATCATTGGTTTCCTCATCCTCGGCCAGAATTTATACCTTGGCGGGGTTCTTGGAATGACG
ATTTTATTGGTGGGAGTTTGCGCGGTCCTATGGGGAAAGGAAGGGGATGACGAAGAAGGGAACATTGATGATAAGTTTGT
AGAAGTTGTCAAGTGTTGTTGTAACGGTTGTGAAATCAAGGTTCTCTCTATGATGATGCCAAGAATCGATGAGGAAGTAG
ACGTTGAAATGCAGTCTCCTGAGAAAGCTAATGTGGCTGTGGGCTTCTCGTAG