Details for Capsella Locus Carubv10017638m

Position : scaf_5 ( 5`- 11201018 .. 11203252 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017638m

Protein [Map View]
MSSVRNTHWCHRCQRAVWLRARDAVCSYCGGGFVEEIDLGPSSPFDMLRAHRDVERDPTFDLMEAFSAFMRSRLAERNYD
REISGRLGSAGSESFSNLAPLLIFGGQAPFRLAGGDNNNSVEAFVNGAAPGIGITRGTNAGDYFFGPGLEELIEQLSSGT
HHRGPPPAPKSSIDALPTIKITQKHIKSSDSHCPVCKDEFELKSEAKQMPCNHIYHSDCIVPWLVQHNSCPVCRKELPSR
GSSSSTQSNQNRSTSTGRENNRRRNIFSNLWPFRSSSSSSTQNRRDTNNTTTTEEGHYQHHQQQQQQHQHHQQQSHMGYS
GWPFDY*

DNA
ATGTCAAGTGTTCGGAATACCCATTGGTGTCACAGATGTCAGCGTGCTGTTTGGCTTCGAGCTCGGGATGCTGTTTGTTC
ATATTGTGGAGGAGGATTTGTTGAGGAAATCGATCTTGGACCGAGTAGCCCCTTTGATATGCTTAGAGCTCACAGGGATG
TTGAGCGTGATCCAACCTTTGATCTCATGGAAGCTTTCTCTGCTTTTATGAGAAGCCGCTTAGCTGAAAGAAACTATGAC
CGGGAGATTAGCGGAAGACTTGGCTCTGCGGGTTCTGAAAGCTTTTCAAACTTAGCTCCTCTATTGATCTTCGGTGGACA
AGCTCCCTTTAGATTGGCTGGTGGAGATAATAATAATTCAGTTGAAGCCTTTGTCAATGGCGCAGCACCTGGAATTGGTA
TCACGCGTGGCACCAATGCCGGAGACTACTTTTTCGGACCTGGTCTTGAAGAACTGATTGAACAGCTTTCATCGGGCACT
CATCATCGAGGCCCACCACCAGCACCAAAATCATCAATTGATGCATTGCCAACCATCAAGATCACACAGAAGCATATCAA
GTCATCAGACTCTCACTGCCCGGTTTGCAAGGACGAGTTTGAACTGAAATCAGAAGCAAAACAGATGCCGTGTAACCATA
TCTATCATTCTGACTGCATTGTCCCGTGGCTGGTTCAGCATAACTCATGCCCAGTCTGTCGTAAAGAGTTACCATCAAGA
GGATCTTCTTCAAGCACACAGAGTAATCAGAACAGAAGCACCAGTACTGGAAGAGAAAACAACAGGAGAAGGAATATCTT
CTCTAACCTCTGGCCATTCCGCTCGTCTAGCTCAAGCTCGACTCAAAACCGTAGAGACACAAACAACACAACGACTACAG
AAGAAGGGCACTATCAACATCACCAGCAGCAACAGCAACAACATCAACATCATCAGCAACAATCACATATGGGTTACAGT
GGATGGCCTTTTGACTACTAA