Details for Capsella Locus Carubv10017620m

Position : scaf_5 ( 5`- 11079252 .. 11081191 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017620m

Protein [Map View]
MGNAIRLLRKCLNHTTDDKPHGGAASSPGVSALSRDLFNFETTSQVPEKLGSYVVSSTKAQANWYRKILEAWKQSKPPPK
TPEEASRLVIASLKNHQKADVEGLLTFYGLPSPHNLVEVPTESPVSLPQGVRFELKTLPVDTKSVADGDTVTVYVSSKDP
LVSSSVPKEVSIAAVKRAKAREKRNYTEADALHKKIISSGYRMISFQNEEVLAKKFRIRLSGIDSPESKMPYGKEAHDEL
LKMVEGKCLKVLVYTEDRYGRCVGDIYCNGKFVQEVMLKKGLAWHYVAYDKRAELAKWENEARQKRIGLWASSNPEKPWE
WRKNKRGGN*

DNA
ATGGGTAACGCGATTAGGTTACTCCGGAAATGCTTAAATCACACGACGGACGATAAGCCTCACGGCGGCGCCGCCTCTTC
CCCCGGCGTATCAGCTCTTTCCCGTGATCTCTTCAACTTCGAAACCACTTCTCAGGTTCCTGAAAAGCTTGGGAGTTACG
TTGTATCTTCTACAAAGGCTCAAGCAAACTGGTATAGAAAAATACTTGAGGCATGGAAGCAATCTAAGCCTCCGCCTAAA
ACTCCTGAGGAAGCCTCTAGGCTTGTTATCGCGTCTTTAAAGAACCATCAAAAAGCAGATGTTGAGGGACTTTTGACTTT
CTATGGACTGCCTTCGCCTCACAATCTTGTTGAGGTCCCTACAGAATCTCCTGTGTCTTTACCTCAAGGAGTTCGGTTTG
AGCTCAAAACGCTTCCGGTGGATACAAAATCTGTGGCAGATGGAGATACCGTTACTGTATATGTTAGTAGCAAAGACCCG
CTTGTGTCATCTTCTGTTCCTAAGGAAGTGAGTATTGCAGCGGTTAAAAGAGCCAAAGCTCGTGAGAAGAGGAATTATAC
TGAAGCAGATGCACTTCACAAGAAGATCATATCTTCTGGTTACAGGATGATAAGTTTTCAAAATGAGGAAGTGCTTGCTA
AAAAGTTCAGAATTAGACTAAGCGGAATAGATTCACCGGAGAGCAAAATGCCGTATGGAAAAGAGGCGCATGATGAGCTA
CTCAAGATGGTAGAAGGGAAATGCTTGAAGGTGTTAGTTTATACAGAGGATCGTTATGGAAGATGTGTAGGAGATATATA
CTGCAATGGAAAATTTGTACAGGAAGTAATGCTAAAGAAAGGTCTTGCTTGGCATTATGTAGCCTACGACAAGCGTGCAG
AGCTTGCCAAGTGGGAAAATGAGGCTAGGCAAAAGCGTATCGGCTTGTGGGCATCTTCTAATCCAGAGAAGCCATGGGAG
TGGAGAAAGAACAAACGTGGAGGCAATTAA