Details for Capsella Locus Carubv10017349m

Position : scaf_5 ( 5`- 11152805 .. 11154527 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017349m

Protein [Map View]
AKFDIPFSLRDEMTSSITTSSILRHEAPQAKTKGWISLSSISFPHTSHYLPSHFLSSSSLSKKKNQTSPTTTTKKEKKKK
KRSHHYKSSFPPYIYTHFSSFPLIIQTTPREQNRKKKKKTHQMDTKKALKLKAMNHQLVEGHEFATKLQQLLSQPGSGHG
LAEDLAAKIVVTFNKAISVLDSFEPISSSSSSLAAVEGSQNASCDNDGKFEDSGDSRKRLGPVKGKRGCYKRKKRAETWT
MHSTVLDDEFSWRKYGQKEILNAKFPRSYFRCTHKFTQGCKATKQVQKMELEPKMFSITYMGTHTCNTNTATPTIKGCDD
HQDEITMDSEEHKSPSLLTTSMKEEEENHLHHHGSSTENNLVWQDLVFEEDHHHHHQAIYVCGETSQELMVFGAGGDFEF
SDSIFDSCSNLC*

DNA
GCAAAATTCGATATTCCATTCTCACTGAGAGATGAAATGACATCATCGATCACTACATCATCGATCTTACGTCACGAAGC
TCCACAGGCAAAAACCAAAGGGTGGATAAGTTTAAGTTCCATCTCATTTCCTCACACCTCTCACTATCTTCCTTCTCATT
TCCTCTCATCTTCCTCTCTCTCCAAAAAAAAAAATCAAACAAGCCCAACAACAACAACCAAAAAAGAAAAGAAAAAAAAA
AAAAGATCTCATCATTACAAATCTTCTTTTCCACCTTATATTTACACACACTTCTCTTCTTTCCCTTTAATCATACAAAC
CACACCAAGAGAGCAAAATAGAAAGAAGAAAAAAAAAACCCACCAAATGGATACTAAGAAAGCATTAAAGCTTAAAGCTA
TGAACCACCAACTCGTTGAAGGCCATGAGTTTGCCACTAAGCTTCAGCAACTCCTCTCTCAACCCGGGTCTGGTCATGGT
CTAGCGGAGGACTTAGCGGCTAAAATTGTAGTGACTTTTAACAAGGCCATCTCCGTTCTTGATTCCTTCGAACCCATCTC
CTCCTCCTCCTCCTCTCTTGCTGCCGTCGAGGGCTCTCAAAATGCTTCTTGTGACAACGACGGCAAGTTTGAAGATTCCG
GAGACAGTCGGAAAAGATTGGGACCCGTTAAGGGCAAAAGAGGATGCTACAAAAGAAAGAAGAGAGCGGAGACGTGGACT
ATGCATTCGACTGTGCTTGATGATGAATTTTCTTGGAGGAAATATGGACAAAAGGAGATTCTTAATGCCAAATTCCCAAG
AAGTTACTTTAGGTGCACACACAAGTTCACTCAAGGGTGCAAGGCAACAAAGCAAGTCCAGAAGATGGAGCTCGAACCCA
AGATGTTCAGCATCACATACATGGGAACCCACACGTGTAACACAAACACAGCAACACCCACGATCAAGGGTTGTGATGAT
CATCAGGATGAGATCACCATGGATTCGGAAGAGCACAAGAGTCCTAGTTTGTTGACTACCTCAATGAAGGAGGAGGAAGA
GAACCATCTTCATCACCATGGTTCGTCCACGGAGAATAACTTGGTGTGGCAAGATCTAGTGTTCGAAGAGGATCATCATC
ATCACCATCAGGCCATTTACGTTTGTGGTGAAACTTCTCAGGAGCTCATGGTGTTTGGCGCTGGCGGCGATTTCGAGTTC
AGCGACTCTATCTTCGATTCATGTTCCAATCTATGTTGA