Details for Capsella Locus Carubv10017295m

Position : scaf_5 ( 5`- 11088128 .. 11091583 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017295m

Protein [Map View]
MSPQIEAQLLPKSSEKHGSSSTSGVVFNVSTSIIGAGIMSMPAAFKVLGIIPAFLIIAIIAWLSTISVQFLMKSTLAGES
TTYAGVMNESFGKTGSIAVQIATMVATFGCMIIFSIIIGDVLSGNEDDGSEHIGVLQEWFGSYWWNSRIFALLFIYCFLL
LPLVLCRRVERLAFSSAVSFLLAVLFVVISSVLAISALVNGKTENPRLFPDLNNGGSFWKLFTASPVIVTAFTFHFNVHP
IGFELKDPLHVIPATKISVILCAAIYFATGLFGYLLFGDAIMSDILVNFDQSSGSSIGSLLNDIVRLSYALHLMLVFPLL
NFSLRANLDELLFPKKQSLAKDTKRFIGLTLALLICCFLSAIAVPDIWYFFQFLGSTTTVSIAFIFPAAIVLRNVHGVST
SREKLLAAIMLLLAVATSIIAISTNLYSLAAN*

DNA
ATGTCACCACAGATCGAAGCTCAACTCTTGCCAAAGTCGTCTGAGAAGCATGGATCATCATCAACCTCCGGCGTTGTTTT
CAACGTGTCCACCAGCATTATCGGAGCCGGTATAATGTCAATGCCGGCGGCGTTTAAGGTTCTCGGAATCATCCCTGCGT
TTTTGATAATCGCCATCATAGCTTGGCTTTCCACTATTTCTGTCCAATTTCTCATGAAATCAACACTCGCCGGAGAATCA
ACTACTTACGCCGGAGTTATGAATGAGTCGTTCGGGAAAACAGGATCCATAGCTGTACAGATTGCTACGATGGTTGCTAC
TTTTGGATGTATGATTATTTTCTCCATTATTATAGGAGATGTGCTTTCGGGTAATGAAGATGATGGATCTGAACATATTG
GAGTTTTGCAAGAATGGTTTGGTTCTTACTGGTGGAACTCGAGAATCTTCGCTCTGTTGTTTATCTACTGCTTCCTCTTG
CTTCCTTTGGTCTTGTGCAGACGTGTTGAAAGACTGGCCTTTAGTTCTGCGGTATCGTTTCTTCTTGCGGTTCTATTTGT
TGTCATAAGCTCGGTGCTGGCCATTTCCGCGCTGGTGAATGGAAAAACGGAGAATCCAAGACTATTTCCTGACTTGAACA
ATGGAGGATCGTTTTGGAAACTCTTTACAGCTTCCCCTGTTATAGTTACAGCCTTCACGTTTCATTTCAATGTTCATCCA
ATTGGATTCGAGCTCAAAGATCCATTACATGTGATCCCAGCAACTAAGATCTCTGTCATATTGTGCGCTGCTATCTACTT
CGCCACTGGACTCTTTGGGTACCTTCTGTTTGGAGATGCAATCATGTCAGATATTCTAGTGAACTTTGATCAGAGCTCTG
GTTCCTCCATTGGTTCTCTTCTCAATGACATTGTCAGACTGAGCTACGCGCTTCACCTCATGCTAGTCTTTCCTCTCTTG
AACTTCTCGTTGAGAGCAAATCTCGATGAACTCTTGTTCCCTAAGAAGCAGTCCTTAGCAAAAGACACAAAAAGATTCAT
CGGACTCACTCTGGCTCTTTTGATTTGCTGTTTCTTGTCAGCAATCGCTGTACCAGACATTTGGTACTTCTTTCAGTTCT
TGGGATCAACCACCACAGTTTCAATTGCATTTATATTTCCAGCCGCCATTGTTCTAAGGAATGTCCATGGTGTATCAACT
TCAAGAGAGAAGCTCCTAGCTGCGATAATGCTTCTTCTTGCAGTTGCTACTAGCATTATTGCTATTTCGACAAATTTATA
CAGCCTTGCAGCAAACTAG