Details for Capsella Locus Carubv10017250m

Position : scaf_5 ( 5`- 11165930 .. 11168347 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017250m

Protein [Map View]
MVKPSDFKAVHRLIQLHCSRVNVVATGRSKLSALSFPALPSNGVSQLQPKSGFHSFSSRPTLKNFGLSQILPSNGVSQLK
PKTSFHSFLSRPTSKNVGLFQILSSPKLVPSLQNCGVALVKPRVNMNFASAFRLFSSSGFRKVDGNFARKVVDKPIQAVS
STFARYRMALGLHIDAFWKKNNLLVFGAGAVFVCIFLWRIMFGIASTFVGLSEGMAKYGFLALSSAIVAFAGLYLRARFT
INPDKVYRITMRKLNTAADVLEVMGAPLAGSDLRAYVMSGGGITFKRFKPSIRNKRCFLLFPVQGSERKGLVSVEVKKKK
GQYDMKLLAVDIPMASGPDQRLFLIGDEEEYRVGGGLISELRDPVVKAMAATKEFDNLDRIEEEEDAERELQEAERKQRE
EEERKQREEIELEEEERKQREELELEKAERKQREETEKLEKQSS*

DNA
ATGGTGAAACCCTCCGATTTCAAAGCAGTTCATAGACTTATTCAGTTGCATTGCAGTCGAGTTAACGTGGTCGCGACGGG
CCGGTCAAAACTTTCCGCTTTGTCTTTTCCGGCTCTTCCTTCAAATGGGGTTTCTCAGCTTCAGCCTAAGTCCGGTTTCC
ACAGCTTTTCGTCGCGACCCACTTTGAAAAACTTTGGCTTGTCCCAGATTCTTCCCTCAAATGGGGTTTCTCAGCTTAAG
CCTAAGACCAGTTTCCACAGCTTTTTGTCGAGACCTACGTCGAAAAATGTGGGATTATTCCAGATTCTATCAAGTCCTAA
GCTCGTACCTAGTTTGCAGAATTGTGGCGTAGCCTTGGTTAAGCCCCGTGTGAATATGAACTTTGCATCGGCTTTTAGAT
TGTTTTCGAGCTCTGGATTCCGAAAGGTCGATGGGAATTTCGCTAGGAAGGTTGTTGACAAGCCAATCCAAGCTGTTAGT
TCGACTTTTGCTAGATACCGAATGGCTTTAGGGTTGCACATTGATGCATTTTGGAAGAAGAATAACCTTTTGGTGTTTGG
AGCAGGGGCTGTTTTTGTTTGTATTTTCTTGTGGAGGATCATGTTTGGAATTGCTAGCACATTCGTGGGTCTCTCTGAGG
GAATGGCCAAGTACGGCTTCCTTGCTCTCTCCTCTGCCATTGTTGCATTTGCTGGTCTATACCTTCGCGCAAGGTTCACG
ATAAATCCCGATAAAGTCTATAGGATCACCATGAGGAAGCTCAATACGGCGGCTGATGTTCTTGAAGTTATGGGTGCCCC
TCTGGCAGGATCAGATTTGCGTGCTTATGTGATGTCAGGTGGTGGCATAACATTCAAGAGATTCAAGCCATCAATTAGGA
ACAAGCGTTGCTTTCTCCTATTCCCGGTTCAAGGTTCTGAGAGAAAGGGCCTCGTTAGTGTCGAAGTGAAGAAGAAGAAA
GGCCAGTATGATATGAAGCTACTGGCAGTGGATATTCCAATGGCGTCTGGTCCTGATCAACGTTTATTCCTTATTGGTGA
TGAAGAAGAGTACAGAGTCGGTGGTGGTTTGATCTCTGAGTTAAGAGATCCTGTGGTAAAAGCAATGGCAGCAACCAAAG
AGTTTGATAACCTTGATAGAATTGAAGAGGAAGAAGACGCAGAAAGAGAACTTCAAGAAGCCGAAAGAAAACAGCGTGAA
GAAGAGGAAAGAAAGCAGCGTGAAGAAATTGAACTTGAAGAAGAGGAAAGAAAGCAGCGTGAAGAACTGGAACTTGAAAA
AGCGGAAAGGAAGCAGCGTGAAGAAACTGAGAAGCTCGAGAAACAGAGTTCTTAG