Details for Capsella Locus Carubv10017084m

Position : scaf_5 ( 5`- 11204329 .. 11207833 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017084m

Protein [Map View]
MGKNTDEEQNLPVSDGAASSRNNGGGINSCCCCVSISSYFSLRCVFILAFSAAVFLSALFWLPPFLGLADRGDLDLDPRF
KDHRIVASFDVGKPVSFMEDNLLQLENDITDEISFPMTKVVVLALERLGDLNRTMVVFAIDPEKEHSKIPAEIESLIKAA
FETLVQKQLSFRLTESLFGEPFLFEVLKFPGGITVIPPQPIFPLQKAQLLFNFTLNFSIYQIQSNFEELTSQLKKGINLA
PYENLYITLSNCRGSTVAPPTIVHSSVLLTVGSSSRLKQLAHTITSSHSKNLGLNHTVFGKVKQVRLSSILPQSPATSSS
PSPSPQPETHEHHHHHSHPHHHHHHHQELAPEPSTSPPTKGLAPASAPTKHSSLPPRKPPCPYEQRRPKGNNALNHHTAA
PTPAPHRSQPHPLPLPPAPNPTRPHRHAIPVSSPLPHVVFTHIPPPSKSSPETEPNREQTPSPSPTPSSASMGPTLKKAS
SKLFVVVAVVIICL*

DNA
ATGGGGAAGAATACTGACGAAGAGCAGAATCTTCCTGTGAGCGACGGAGCCGCTTCGTCTAGGAATAACGGAGGAGGAAT
CAACAGTTGTTGTTGCTGCGTTTCGATCTCTAGCTACTTTAGTCTCAGATGCGTTTTCATTCTTGCTTTCTCTGCTGCTG
TCTTCCTCTCCGCCTTGTTCTGGTTACCTCCATTCCTCGGATTAGCAGATCGAGGGGATCTAGATCTCGATCCAAGGTTT
AAAGATCACCGAATAGTGGCAAGTTTTGATGTTGGAAAACCAGTTTCGTTCATGGAAGACAATTTGTTGCAGCTTGAGAA
CGATATCACCGATGAAATAAGCTTTCCCATGACCAAAGTTGTGGTATTAGCGCTTGAACGCTTGGGTGATCTTAACAGAA
CAATGGTTGTTTTTGCCATTGATCCCGAGAAGGAGCATTCTAAGATACCTGCCGAAATTGAGAGCCTGATCAAGGCAGCT
TTTGAAACTCTTGTTCAAAAGCAGTTGTCTTTCCGCTTGACTGAATCCTTGTTTGGGGAACCGTTCCTTTTTGAAGTGCT
AAAATTCCCTGGAGGAATTACTGTGATCCCTCCCCAGCCTATATTTCCCCTGCAGAAGGCGCAACTTCTCTTCAATTTCA
CATTGAACTTTTCGATTTACCAAATTCAATCAAACTTTGAGGAACTCACTAGCCAGCTGAAGAAGGGTATTAATCTGGCT
CCTTATGAGAACTTGTACATAACCTTGTCAAATTGTAGAGGTTCAACAGTGGCGCCTCCTACAATAGTTCATTCTTCTGT
TCTGCTTACAGTCGGCTCTTCTTCAAGGTTGAAGCAACTTGCTCACACCATCACTAGCTCCCATTCCAAAAATCTCGGCC
TAAACCACACTGTATTTGGTAAAGTTAAGCAAGTCCGTCTTTCCTCGATCTTACCACAGTCACCCGCCACATCATCATCC
CCTTCCCCTTCTCCTCAGCCTGAAACCCACGAACACCATCATCATCATTCTCATCCCCATCATCATCATCACCACCATCA
AGAACTTGCTCCAGAACCTTCAACTTCGCCTCCAACTAAAGGCTTGGCACCTGCATCAGCACCAACCAAACACTCATCTT
TACCCCCGAGGAAGCCGCCTTGTCCTTATGAGCAGAGGAGACCGAAAGGAAACAACGCTCTGAACCATCATACTGCAGCA
CCAACGCCTGCACCACACCGGTCTCAGCCACACCCACTCCCACTTCCACCAGCACCAAACCCTACCCGGCCACATCGTCA
TGCCATCCCTGTATCTAGTCCACTTCCTCACGTTGTATTTACACATATCCCACCTCCATCAAAAAGCAGCCCAGAAACAG
AACCAAACAGAGAACAAACTCCCTCACCTTCCCCAACTCCATCTTCGGCGAGCATGGGTCCAACCTTAAAAAAGGCATCA
TCGAAGCTCTTTGTAGTAGTAGCTGTTGTAATTATCTGTCTCTAA