Details for Capsella Locus Carubv10017003m

Position : scaf_5 ( 5`- 11197947 .. 11200656 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10017003m

Protein [Map View]
MATTRRLRAFKRWMKANGVDCSDALNLVDDQNDGVSVRALCDLKEGDVVANISKPACLTIKTSGAREIIKSADLDGSLGL
SVALMYERSLGEKSPWAGYLQSLPIQEDLPLVWSLQDVDSLLSGTELHKVVKEDHVLICEDWEENILPLTSSLPQNVDPD
SFGIKDYLAAKSLIASRSFQIDDYHGSGMVPLADLFNHKTGAEDVHFTAESSHSESDTDESDNGDAVNEANDEDEPSSKS
SSSPEQSFEEVPAEITDEEANKEEEEEEEEEEEDEENSSMLQDDLSCLKMIMVKDVPAGAEVFNTYGLMGNAALLHRYGF
TEPDNPYDIVNIDLELVTEWSSSSFTSRYTRARLALWRKLGYTGCESQNSEYFEISSTGEPQSELLILLYIVLLPDDAYN
KLDLAISTKASLSKEGKRSSSSSSYEITIGKHKFKLGQSGNDVLLTEGVCEALLAIVDKRESLYGSLTSLEDDIGGLKAC
CLPRDRRLYHSLVLRVSERKILKQLRSYIRTNAKEFSGGKRRKKVVSKS*

DNA
ATGGCCACAACAAGGAGGTTAAGAGCATTCAAGAGATGGATGAAAGCGAACGGAGTTGATTGCAGCGACGCTCTCAACCT
CGTTGACGACCAAAACGACGGTGTCTCTGTGAGAGCATTATGCGATTTGAAAGAAGGAGATGTCGTCGCCAATATCTCGA
AACCTGCTTGTCTCACTATCAAAACCAGTGGAGCTCGTGAGATTATCAAATCAGCTGATTTAGATGGAAGTTTAGGTCTC
TCTGTTGCTCTCATGTACGAGAGAAGCTTAGGTGAAAAGTCCCCTTGGGCTGGTTATCTTCAGTCTCTTCCTATTCAAGA
GGATTTGCCTCTAGTTTGGTCCCTTCAAGACGTGGATTCTCTCTTATCTGGAACTGAGCTTCATAAGGTTGTGAAGGAAG
ATCATGTTCTTATATGTGAGGATTGGGAAGAAAACATTTTGCCACTTACCTCTTCACTGCCTCAGAATGTTGATCCTGAT
TCCTTTGGGATTAAAGACTATCTTGCTGCTAAGAGTCTAATTGCTTCACGGTCTTTTCAGATCGATGACTACCATGGATC
CGGGATGGTTCCTCTTGCAGATCTCTTCAATCATAAAACTGGGGCAGAAGACGTTCATTTTACTGCTGAATCATCTCACA
GTGAATCCGATACTGATGAATCTGACAATGGTGATGCTGTAAATGAGGCCAATGATGAAGATGAGCCTTCCAGTAAAAGT
TCCTCCTCGCCTGAGCAATCTTTTGAGGAAGTTCCTGCTGAAATCACTGACGAAGAAGCCAACAAAGAAGAAGAAGAAGA
AGAGGAGGAAGAAGAAGAAGATGAAGAGAACTCATCGATGTTGCAAGATGATCTATCCTGTTTAAAAATGATTATGGTGA
AGGATGTTCCAGCTGGAGCTGAGGTATTCAATACATACGGGTTGATGGGGAATGCTGCGTTACTCCACAGATACGGATTT
ACAGAGCCTGATAATCCCTACGATATAGTAAACATAGATTTAGAATTAGTAACGGAATGGAGCTCATCCTCATTCACAAG
CCGGTACACCCGAGCTAGACTCGCCTTGTGGAGAAAACTAGGTTACACAGGATGCGAGAGCCAAAACTCTGAATACTTTG
AGATTTCTTCAACTGGAGAACCCCAAAGTGAGCTCTTGATACTACTCTACATAGTGCTCTTACCAGACGACGCATACAAC
AAACTGGATCTAGCTATATCAACAAAAGCAAGTCTCTCAAAAGAAGGAAAGAGATCTTCGTCCTCCTCTTCTTACGAGAT
AACAATCGGGAAACACAAGTTCAAGCTTGGACAAAGTGGAAACGATGTTCTTCTCACAGAAGGTGTTTGTGAAGCTCTTC
TTGCTATCGTGGATAAGCGAGAGAGCTTATATGGATCATTGACGTCTTTGGAAGACGACATTGGTGGACTCAAAGCTTGT
TGTCTTCCAAGAGACAGGAGACTATATCATTCGCTTGTGTTGCGTGTGAGTGAGAGGAAGATTCTGAAGCAGCTCAGGAG
CTACATCCGTACAAATGCCAAAGAGTTTTCCGGTGGAAAGCGCCGGAAGAAGGTGGTTTCAAAATCCTAG