Details for Capsella Locus Carubv10016985m

Position : scaf_5 ( 5`- 11121075 .. 11123542 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016985m

Protein [Map View]
MEMEKPELTLYNTMTQVKEVFKPINPGKIGMYVCGITSYDFSHIGHARAAVSFDLLYRYLRHLGYEVTYVRNFTDVDDKV
IGRANKCGENPLALSSRFCEEYLVDMAALQCLLPTHQPRVSDHMELIIKMIEKIIENGCGYEVGGDVFFSVDKSPNYGQL
SGQRLDHTQAGKRVAVDSRKRNPADFALWKAAKPGEPSWESPWGPGRPGWHIECSAMSAHYLSPRFDIHGGGADLKFPHH
ENEIAQTCAACEDSGVNYWLHNGHVTNNNVKMGKSLDNFFTIREITAKYHPLALRHFLISAQYRSPLNYSVSQLESSSDA
LYCVYQTLEDLIKALSPYREEMSKDVGKTEQTAEAKDLIKKVKSEFETKMSNDLNTAHILTGAFQDAMKFINVSTTKLKK
MQRKQRMSLVASLVEVEKSVREVLDVLGLLTTLSYAEFLKEMKEKALTRAGIGEAEVLRRIEERKLARKNKEFKRSDQIR
ELLAVKGIALEDIPGDTVWRPCTPLTLSSKPKSGLGKTAFVFAIGFALLGLFFYSR*

DNA
ATGGAGATGGAGAAGCCGGAGTTGACATTGTACAACACGATGACTCAAGTGAAGGAAGTTTTTAAGCCGATCAATCCCGG
CAAGATCGGAATGTATGTCTGCGGTATCACCTCCTACGATTTTAGCCATATTGGTCACGCTCGTGCCGCCGTCTCCTTTG
ACCTCCTTTACAGATACTTAAGGCACTTGGGTTATGAGGTTACTTATGTTCGGAATTTTACAGATGTTGATGACAAGGTG
ATTGGAAGAGCTAACAAGTGTGGGGAGAACCCTTTAGCTTTGAGTAGTCGCTTTTGCGAGGAGTATCTTGTAGATATGGC
TGCTCTTCAGTGCCTCCTTCCCACCCACCAGCCTCGTGTCAGTGACCATATGGAGCTCATAATTAAGATGATTGAAAAGA
TCATTGAGAACGGGTGTGGCTATGAAGTGGGTGGTGATGTGTTCTTCTCAGTGGATAAATCACCCAATTATGGTCAACTA
TCTGGGCAACGGCTGGATCATACTCAAGCTGGTAAGCGTGTTGCTGTTGATTCCAGAAAGCGCAATCCTGCTGACTTTGC
ATTATGGAAGGCTGCAAAACCTGGTGAACCAAGTTGGGAGAGCCCTTGGGGTCCAGGAAGACCAGGATGGCACATCGAGT
GCAGTGCCATGAGTGCTCATTACCTGTCTCCGAGATTTGACATTCATGGTGGTGGCGCAGATCTGAAGTTCCCGCACCAT
GAAAATGAGATCGCTCAGACATGTGCTGCTTGTGAAGATAGTGGCGTGAATTACTGGTTGCATAATGGGCATGTCACCAA
CAACAATGTAAAGATGGGAAAATCACTTGACAACTTTTTTACAATTAGGGAGATCACGGCTAAGTATCATCCACTGGCTC
TGAGACACTTCTTGATAAGTGCACAGTACCGTTCTCCTCTGAACTACTCGGTGTCGCAGCTAGAGAGTTCATCGGATGCT
TTATATTGTGTTTATCAGACGTTAGAAGACCTTATTAAAGCTTTATCGCCATATCGAGAAGAGATGAGTAAAGATGTTGG
AAAGACCGAACAGACTGCAGAAGCCAAAGACCTGATAAAGAAGGTGAAAAGTGAGTTTGAAACAAAAATGTCAAACGACT
TGAACACTGCACATATACTCACGGGTGCTTTTCAAGACGCAATGAAGTTCATCAACGTTTCAACCACCAAGCTCAAGAAA
ATGCAGAGGAAACAGCGGATGTCACTGGTCGCGTCACTGGTAGAGGTTGAGAAATCAGTGAGGGAAGTTCTAGATGTGCT
TGGTTTGCTCACGACTCTAAGCTACGCTGAGTTTTTAAAAGAGATGAAAGAAAAGGCATTAACAAGAGCAGGAATAGGAG
AAGCAGAGGTCTTGCGGAGGATTGAAGAAAGGAAATTGGCGCGGAAGAATAAAGAATTTAAGAGGAGTGATCAGATTAGA
GAGTTGTTAGCAGTTAAGGGTATAGCACTGGAGGATATACCGGGAGACACGGTGTGGCGACCGTGCACCCCTCTGACGTT
GAGCTCTAAGCCTAAATCCGGTTTAGGCAAGACCGCCTTTGTTTTTGCCATCGGTTTTGCTCTCTTAGGCCTCTTCTTCT
ATAGCCGTTGA