Details for Capsella Locus Carubv10016732m

Position : scaf_5 ( 5`- 11055730 .. 11061146 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016732m

Protein [Map View]
MKLTTNDLFVSQPLFHCPCSSHRPRRRRLHGLHFPINLSNKKNNSLSVAALSDSDLPTQAAFSRRAILLSPLLASAASLI
LKPSVSLASEESSSATVNSPAESAAPPATATAPSPPPAEETITSRIYDATAIGEPMAMGKDKKKVWEKLMNARVVYLGEA
EQVPTKDDKELELEIVRNLRKRCVENDSERQISVALEAFPLDLQDQLNQYMDKRIDGETLKSYVTDWPPQRWQEYESLLS
YCRDNSVRLIACGTPLKVLRTVQAEGIRGLSKAERKLYTPPAGSGFVSGFSSFSRRSTFDMSLPTQIVPFGPSSYLSAQA
RVVEDHTMSQVILQAVADGGGTGLLVVVTGASHVEYGSRGTGLPARISRKFPKKNQVVVLLDPERQYLRREGETPVADFL
WYSAARPCSRNCFDRAEIARVMNAAGRRRDALPPDIQNGLDLGLVSPEVLQNLFDLEQYPLISELTQRFQGFRERLLADP
KFLNRLAIEEAISITTTLIAQYEKRKENFFEELDYVITDTVRGSVVDFFTVWLPAPTLSFLSYADETTGPDSIESLKGLL
GSIPDNAFQKSLAGREWTLNLRIASVVVGGLKLAGVGVVSSFAAVGGSNALNVVRKFIKPELVVAQKPKRSPLLKTAMVY
GGFLGVSANIRYQIIAGLIEHRLSDELSSQPLLVNTISFVVRTLNSYFGTQQWIDLARSTGLQTQKSIPPPTKVPEALEE
STVECDTTAEEESVDKLNNQ*

DNA
ATGAAACTCACCACAAATGATCTCTTCGTTTCTCAACCATTATTTCACTGCCCTTGCTCCTCCCACCGTCCTCGCCGTCG
CCGTCTCCATGGCCTTCATTTTCCGATCAACCTCAGTAATAAGAAGAACAATTCTTTATCCGTCGCTGCTCTTTCTGATT
CCGATCTTCCAACACAAGCCGCTTTCTCTCGCCGCGCTATTCTTCTCTCGCCGCTCCTCGCTTCAGCTGCTTCCTTGATT
CTCAAGCCGTCTGTCTCTTTAGCCTCCGAGGAGAGCTCGTCCGCTACAGTGAATTCGCCTGCGGAATCAGCAGCTCCTCC
TGCGACCGCCACCGCTCCATCTCCGCCGCCTGCGGAAGAGACTATAACCTCGAGAATCTATGACGCTACGGCCATTGGTG
AGCCGATGGCTATGGGAAAAGATAAGAAGAAAGTGTGGGAGAAGCTGATGAACGCGAGAGTTGTGTACCTCGGCGAGGCG
GAGCAGGTGCCTACCAAAGACGACAAGGAGCTTGAACTCGAAATCGTTAGAAACTTGAGGAAGCGATGTGTTGAGAATGA
TAGCGAGCGTCAAATCTCTGTTGCACTAGAAGCATTCCCTCTCGATTTGCAGGACCAGCTTAATCAGTACATGGATAAGA
GGATCGACGGAGAGACATTGAAGTCTTATGTGACAGATTGGCCTCCTCAACGCTGGCAAGAATACGAGTCTCTTTTAAGT
TACTGTCGCGATAACTCTGTTAGACTAATTGCTTGCGGCACTCCTCTCAAGGTTTTAAGAACTGTCCAAGCAGAGGGTAT
CCGTGGACTTTCAAAGGCTGAGCGTAAATTATACACTCCCCCTGCTGGTTCTGGGTTTGTCTCAGGATTTTCTTCATTCT
CACGGAGATCTACATTCGATATGAGCCTCCCGACACAGATTGTTCCGTTTGGACCAAGCTCTTATTTGTCGGCACAAGCA
AGGGTTGTCGAAGACCATACAATGTCACAAGTTATTTTACAAGCAGTAGCAGATGGAGGGGGTACTGGTCTACTGGTAGT
GGTGACAGGGGCAAGTCATGTTGAGTATGGTTCAAGAGGAACAGGTTTGCCAGCAAGGATCTCAAGGAAGTTTCCAAAGA
AAAACCAAGTCGTTGTATTACTTGATCCTGAAAGACAGTACTTGCGAAGAGAGGGCGAAACTCCAGTTGCTGATTTCTTA
TGGTATTCTGCTGCAAGGCCCTGCAGTAGAAACTGTTTTGACCGAGCCGAAATTGCTAGAGTAATGAATGCTGCTGGCAG
GAGGCGAGATGCCCTTCCACCGGATATTCAAAATGGATTAGACCTTGGTCTGGTGTCACCTGAGGTTCTGCAGAATCTAT
TTGATTTAGAGCAGTATCCTCTTATTTCTGAGCTTACTCAGCGGTTCCAGGGTTTCCGAGAAAGGTTGTTGGCTGATCCA
AAATTCCTGAATAGGTTAGCTATTGAAGAGGCTATATCAATAACAACCACACTTATAGCACAATATGAGAAGCGGAAAGA
GAATTTCTTTGAAGAACTCGACTATGTTATAACTGATACAGTGAGAGGATCAGTCGTTGATTTTTTCACAGTTTGGCTTC
CTGCGCCAACTTTGTCTTTTCTATCATATGCTGACGAGACCACCGGACCAGACAGCATAGAATCCCTGAAAGGCCTCCTA
GGATCCATACCTGATAATGCATTTCAAAAGAGTCTTGCTGGAAGAGAGTGGACTCTGAATCTTAGAATTGCCTCAGTTGT
TGTTGGTGGCTTGAAGCTTGCTGGTGTTGGAGTTGTTTCCAGTTTTGCGGCTGTGGGAGGGTCAAATGCATTGAATGTGG
TACGGAAGTTCATTAAACCCGAGTTGGTTGTTGCTCAGAAGCCAAAGAGGTCTCCTCTTCTGAAAACGGCAATGGTTTAT
GGAGGTTTTCTGGGAGTATCTGCAAATATTCGTTACCAGATAATTGCTGGATTAATAGAGCATCGTCTATCTGATGAGCT
TTCTTCTCAACCTCTACTTGTAAATACGATTTCATTTGTTGTCAGGACACTTAATTCATATTTCGGAACACAGCAATGGA
TTGATCTTGCACGGTCTACTGGTCTGCAAACTCAGAAAAGCATTCCACCCCCTACCAAAGTTCCAGAGGCTTTGGAAGAA
TCTACGGTGGAATGCGATACTACTGCTGAAGAGGAAAGTGTTGACAAGCTCAATAATCAATGA