Details for Capsella Locus Carubv10016672m

Position : scaf_5 ( 5`- 11060291 .. 11065474 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016672m

Protein [Map View]
MTSRFFAQGGSESEDESEIDEEVPEVQNNDINNRYLQSGSEDEEDLDTKRVVKPAKDKRFEEMTSTVEQMKNAVKINDWV
SLQENFDKVNKQLEKVMRITEAVKPPTLYIKMLVMLEDFLNEALANKEAKKKMSTSNSKALNSMKQKLKKNNKQYEDDIN
KYRESPEVEDEKEPEEDDEEDEEDEDDSEDNGNVDPESEEEIDEPADNLSWEKMLSKKDKLMEKLINKDPKEITWDWVNK
KFKEIVAARGKKGTARFELVDQLTHLTKIAKTPAQKLEILFSVISAQFDVNPGLSGHMPINVWKKCVLNMLTILDILVKY
NNIVVDDTIEPDENETSKPADYDGKIRVWGNLVAFLERIDTEFFKSLQCIDPHTREYVERLRDEPMFLALAQNIQDYFER
MGDFKAAAKVALRRVESIYYKPQEVYDAMRKLAEMVEEEEETEEAKEESGPPTSFIVVPEVVPRKPTFPESSRAMMDILV
SLIYRNGDERTKARAMLCDINHHALMDNFVTARDLLLMSHLQDNVQHMDISTQILFNRTMAQLGLCAFRVGMITESHSCL
SELYSGQRVRELLAQGVSQSRYHEKTPEQERMERRRQMPYHMHLNLELLEAVHLICAMLLEVPNMAANSHDAKRRVISKN
FRRLLEISERQAFTAPPENVRDHVMAATRALTKGDFQKAFEVLNSLDVWRLLKNRDSILDMVKDRIKEEALRTYLFTYSS
SYESLSLDQLAKMFDVPEPQVHSIVSKMMINEELHASWDQPTQCIVFHEVQHSRLQSLAFQLTEKLSILAESNERAMESR
TGGGGLDLSSRRRDNNQDYAGAASGGGGYWQDKTNYGQGRQGSRSGYGGGRQNGQWSGQNRGGGYAGRVGSGNRGMQMDG
SSRMVSLNRGVRA*

DNA
ATGACGTCTCGTTTTTTCGCTCAGGGTGGAAGTGAAAGTGAAGATGAGAGTGAAATTGACGAAGAGGTTCCCGAGGTTCA
GAATAACGACATCAATAACCGTTACCTTCAAAGTGGTAGTGAGGATGAAGAAGATCTTGATACCAAACGTGTGGTTAAGC
CTGCTAAAGATAAACGATTTGAGGAGATGACCTCCACCGTTGAGCAGATGAAGAATGCTGTGAAGATCAATGATTGGGTC
AGCCTCCAAGAAAACTTCGATAAGGTCAACAAACAGCTTGAGAAGGTTATGAGGATTACTGAGGCTGTGAAGCCTCCGAC
CCTGTATATCAAGATGCTTGTGATGTTGGAGGATTTCTTGAATGAAGCTCTGGCTAATAAGGAAGCAAAGAAGAAGATGA
GCACCAGTAATTCCAAGGCTTTGAACTCAATGAAACAGAAATTGAAGAAAAACAACAAGCAGTATGAAGACGATATCAAC
AAATATCGCGAGTCTCCAGAAGTCGAGGATGAGAAAGAGCCTGAAGAGGACGATGAAGAAGATGAGGAAGATGAAGATGA
TTCTGAGGACAATGGTAACGTTGACCCTGAGTCTGAAGAGGAGATAGATGAACCTGCTGATAATCTTTCTTGGGAGAAGA
TGCTGAGCAAAAAAGATAAGCTTATGGAGAAGCTGATTAACAAAGATCCTAAAGAGATTACTTGGGACTGGGTCAACAAG
AAGTTTAAGGAAATTGTGGCTGCTCGTGGGAAAAAGGGCACTGCTCGATTTGAGCTAGTTGATCAGCTTACGCACTTGAC
AAAGATTGCCAAGACTCCTGCGCAGAAGCTTGAAATCTTGTTTAGCGTTATTTCAGCACAGTTTGATGTGAATCCAGGTC
TCAGCGGGCACATGCCTATCAATGTCTGGAAGAAATGTGTGCTTAACATGCTCACCATACTGGATATTCTTGTCAAATAC
AATAACATTGTTGTGGATGACACAATTGAACCTGATGAGAATGAAACTTCAAAGCCTGCTGATTATGATGGAAAAATTCG
GGTCTGGGGAAATTTGGTTGCATTCTTGGAGCGGATTGACACTGAGTTTTTCAAGAGTTTGCAATGCATTGATCCCCACA
CACGTGAGTATGTTGAGAGACTGCGGGATGAGCCGATGTTCTTGGCCCTTGCTCAGAACATCCAGGACTATTTCGAGCGG
ATGGGTGATTTTAAAGCTGCTGCAAAGGTAGCCTTAAGAAGAGTTGAGTCAATATATTACAAGCCTCAGGAAGTTTATGA
TGCTATGAGGAAATTGGCAGAAATGGTGGAAGAAGAAGAAGAAACTGAGGAGGCCAAAGAGGAAAGTGGACCTCCTACTT
CATTCATCGTTGTTCCCGAGGTTGTTCCTCGTAAGCCTACCTTCCCAGAGAGCAGCCGTGCTATGATGGACATTCTTGTG
TCCCTTATCTACAGAAATGGAGATGAGCGGACCAAAGCGCGTGCAATGCTATGTGATATTAATCACCATGCGTTAATGGA
CAACTTTGTGACTGCTAGAGACCTCTTGTTGATGAGTCATCTGCAAGACAACGTCCAGCACATGGACATCTCAACACAGA
TTCTTTTTAATAGAACCATGGCGCAGCTTGGTCTTTGCGCCTTCCGGGTTGGAATGATCACTGAGTCCCATAGCTGCCTT
TCCGAGCTGTACTCTGGTCAAAGAGTGAGGGAGTTGCTTGCCCAAGGTGTCTCGCAAAGCCGATACCATGAAAAGACCCC
AGAGCAGGAAAGGATGGAAAGGAGAAGACAAATGCCGTACCACATGCACTTAAACCTTGAGCTCCTGGAGGCAGTTCATC
TCATCTGTGCCATGCTACTTGAAGTCCCAAACATGGCTGCAAACTCCCATGATGCCAAACGCAGAGTGATTAGCAAGAAT
TTCCGTCGCCTGCTTGAGATCAGTGAAAGGCAAGCATTCACAGCACCGCCTGAGAATGTCCGTGACCACGTCATGGCAGC
CACCAGAGCCCTGACCAAAGGGGATTTCCAAAAGGCGTTTGAAGTTTTGAACTCTCTTGATGTCTGGAGGCTGCTCAAGA
ACCGTGATAGTATCCTCGATATGGTGAAAGATAGGATCAAAGAAGAGGCTCTAAGGACTTACCTATTCACATACTCTAGC
TCCTACGAGTCCTTAAGTCTTGATCAGCTGGCCAAGATGTTTGACGTCCCTGAGCCACAGGTCCACAGCATTGTGAGCAA
GATGATGATTAATGAGGAGCTTCATGCAAGCTGGGACCAGCCAACTCAATGCATAGTCTTTCATGAAGTGCAACACAGCA
GATTACAGTCATTGGCTTTCCAGTTAACTGAGAAACTCTCAATTTTGGCAGAAAGCAATGAAAGGGCAATGGAATCTAGA
ACCGGTGGAGGTGGTCTGGATCTGAGTTCAAGGAGAAGGGACAACAATCAGGACTATGCTGGAGCAGCATCAGGTGGTGG
TGGATATTGGCAAGACAAGACAAATTATGGACAAGGAAGGCAAGGTAGCAGATCTGGTTATGGTGGAGGAAGACAAAATG
GTCAGTGGTCAGGGCAGAACCGAGGAGGAGGGTATGCAGGAAGAGTTGGTTCAGGAAACAGAGGTATGCAAATGGATGGC
TCAAGCCGTATGGTGAGTCTCAACCGTGGTGTTCGTGCTTAA