Details for Capsella Locus Carubv10016642m

Position : scaf_5 ( 5`- 11140295 .. 11144288 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016642m

Protein [Map View]
MFKALIFSVWLLSVVLVAPVRSLDPPLNDDVLGLIVFKADLRDPQQKLASWNEDDYTPCSWTGVKCHPRTNRVTELNLDG
FSLSGRIGRGLLQLEFLHKLSLSNNNLTGIINPNLLLSLVNLKVVDLSSNALSGSLSDGFFRQCGSLRVLSLAKNKLTGK
IPVSISSCSSLAALNLSSNRFSGSMPSGIWSLNTLRSLDLSWNELEGEFPEKIDRLNNLRSLDLSRNRLSGPIPSEIGSC
MLLKTIDLSDNSLSGTLPDTFQQLSLCYSLNLGKNALEGEVPKWIGEMRSLETLDLSMNKFSGQVPESIGNLLALKVLNF
SGNGLIGSLPDSTANCINLLALDFSGNSLTGKLPMWIFQDGSRDVSALQNDNSTGGIKKIQVLDLSHNSFSGEIGAGLGD
LRDLEGLHLSRNSLTGPIPSAIGDLKHLGVLDLSHNQLNGTIPRETGGAVSLEELRLDNNLLEGNIPSSIKTCSSLRSLI
LSHNKLVGTIPPELAKLTKLEEVDISFNELTGTLPKQLANLGYLHTFNMSHNHLFGELPAGGIFNGLSPSSVSGNTGICG
AVVNNSCPAVSPKPIVLNPNATFDSYSGEVLPPGAGHKRILLSISSLIAISAAAAIVVGVIAITVLNLRVRASTVSRSAV
PLTFSGGDDFSRSPTTDSNSGKLVMFSGEPDFSTGTHALLNKDCELGRGGFGAVYRTVIRDGYPVAIKKLTVSSLVKSQE
EFEREVKKLGKLRHSNLVKLEGYYWTTSLQLLIYEFLSGGSLYKHLHEAPGGSSLLSWNDRFNVILGTAKCLAYLHQSNI
IHYNIKSSNVLLDSSGEPKVGDYGLARLLPMLDRYVLSSKIQSALGYMAPEFACRTVKITEKCDVYGFGVLVLEVVTGKK
PVEYMEDDVVVLCDMVREALEDGRADECIDPRLQGKFPVEEAIAVIKLGLICTSQVPSSRPHMGEAVNILRMIRCPSGSS
DELGSS*

DNA
ATGTTTAAAGCACTGATTTTTTCAGTCTGGTTGCTGTCGGTGGTGCTGGTTGCTCCGGTGAGATCTCTAGACCCGCCTTT
AAACGACGACGTTTTGGGGCTCATTGTCTTCAAAGCCGATTTACGAGATCCACAGCAAAAGCTTGCTTCTTGGAACGAAG
ACGACTACACTCCTTGTAGCTGGACCGGAGTCAAATGCCATCCCAGAACGAATCGAGTCACTGAGCTTAACCTAGATGGA
TTCTCTCTCTCCGGTCGAATTGGCCGTGGGCTACTTCAGCTTGAGTTTCTTCATAAGCTCTCTCTCTCCAACAACAATCT
GACGGGGATCATTAACCCTAATTTGCTGCTGAGCCTTGTTAACCTTAAAGTTGTTGATTTGAGTAGCAATGCGCTGTCTG
GTTCGCTCTCTGATGGGTTTTTCAGGCAATGTGGGTCATTGAGAGTTTTGTCTCTGGCTAAGAACAAGCTAACTGGGAAG
ATTCCGGTTAGTATAAGCTCGTGCTCATCTCTTGCTGCTTTAAACTTGTCTTCAAATCGTTTTTCTGGTTCTATGCCTTC
CGGAATTTGGTCTTTGAACACTTTAAGATCGCTTGATTTGTCGTGGAATGAATTAGAGGGAGAGTTTCCAGAGAAGATAG
ACAGGTTGAACAACTTGCGTTCGCTTGATTTGAGTAGAAACAGGTTATCTGGTCCTATTCCTAGCGAAATTGGGAGCTGT
ATGCTGCTGAAGACTATTGATCTTAGTGATAATTCTCTGTCTGGGACCTTACCAGATACATTTCAGCAGCTCAGTTTGTG
TTATTCTCTGAACTTGGGAAAGAATGCGTTGGAAGGGGAAGTTCCAAAATGGATCGGAGAAATGAGGAGTCTTGAGACTT
TGGATCTTTCAATGAACAAGTTTTCAGGGCAGGTTCCAGAATCCATAGGCAACCTTCTAGCACTGAAAGTTCTTAACTTT
TCTGGGAATGGGCTTATTGGTAGCTTGCCGGACTCAACAGCCAACTGTATCAACCTCTTGGCCTTGGATTTTAGTGGGAA
TTCACTAACTGGAAAGCTTCCCATGTGGATATTTCAAGATGGTTCTCGTGATGTTTCTGCATTACAGAATGATAACTCCA
CTGGAGGTATCAAGAAGATCCAGGTGTTGGATCTCTCCCACAATTCCTTTTCTGGCGAGATTGGAGCTGGTCTCGGAGAT
CTGAGAGACTTGGAGGGTTTGCATCTGTCCAGAAACTCTCTTACTGGCCCCATCCCCAGTGCAATTGGGGACCTAAAGCA
CTTGGGCGTCCTTGATTTGAGTCACAATCAGCTTAACGGAACGATTCCTCGAGAAACAGGTGGAGCTGTTTCTTTAGAGG
AGTTGAGACTAGACAATAACTTGTTGGAGGGAAATATTCCGTCTTCCATCAAGACTTGCAGTTCCCTTCGGTCTTTGATC
CTGTCACATAACAAACTGGTAGGCACTATTCCACCAGAACTAGCCAAACTTACAAAACTCGAAGAAGTCGACATATCATT
CAATGAACTGACTGGAACGCTTCCTAAACAGTTGGCTAATCTTGGCTATCTTCACACCTTCAACATGTCTCATAACCATC
TCTTTGGAGAACTGCCTGCAGGTGGAATTTTCAACGGATTATCCCCAAGTTCAGTATCAGGAAACACAGGAATTTGCGGT
GCTGTTGTTAACAACTCTTGTCCAGCTGTCTCCCCTAAACCAATTGTGTTGAATCCTAATGCAACTTTTGATTCTTACTC
GGGTGAAGTACTGCCTCCTGGTGCTGGTCACAAAAGGATACTTCTTAGTATATCTTCTTTAATTGCCATTAGTGCTGCTG
CAGCCATTGTGGTTGGTGTAATAGCCATCACAGTACTTAATCTGAGAGTGCGGGCATCAACAGTTTCAAGATCAGCTGTA
CCGCTCACGTTCTCAGGTGGAGATGACTTCAGCCGTTCTCCCACTACTGATAGCAACTCAGGGAAGCTTGTGATGTTCTC
AGGTGAACCTGATTTCAGCACGGGAACGCATGCTCTGCTTAACAAAGACTGTGAGCTCGGTCGAGGTGGATTTGGAGCAG
TGTACAGAACAGTTATCAGAGATGGGTATCCAGTGGCTATCAAGAAGCTCACTGTCTCGAGTCTTGTCAAGTCTCAGGAA
GAATTCGAAAGGGAGGTCAAGAAACTTGGGAAACTCAGGCATTCAAATCTGGTTAAACTCGAAGGTTATTACTGGACAAC
ATCTCTTCAGCTTCTTATCTATGAGTTTCTCTCTGGTGGGAGTTTATATAAACACTTACACGAAGCACCAGGAGGTAGTA
GCTTGCTTTCTTGGAATGACCGGTTCAACGTCATCCTCGGTACAGCCAAATGCTTAGCCTATTTGCACCAGTCAAACATC
ATCCACTACAACATCAAATCGAGCAATGTGTTGCTAGACAGCTCTGGTGAGCCTAAAGTCGGAGACTACGGATTAGCGAG
GCTGTTACCCATGCTAGATAGGTACGTTCTAAGCAGTAAGATACAGAGCGCTTTGGGATACATGGCTCCAGAGTTTGCCT
GTAGAACGGTGAAAATAACAGAGAAATGCGATGTCTACGGATTTGGAGTCTTGGTTCTTGAAGTGGTTACGGGTAAAAAG
CCTGTGGAATATATGGAGGATGATGTTGTGGTTCTGTGTGACATGGTGAGAGAAGCCCTTGAAGATGGAAGAGCAGATGA
ATGTATTGATCCGAGGCTGCAAGGGAAGTTTCCGGTAGAAGAAGCGATTGCAGTGATAAAACTAGGGCTTATTTGCACTT
CTCAGGTTCCATCTAGTAGACCACATATGGGAGAAGCTGTTAACATATTGAGGATGATCAGATGCCCTTCAGGAAGCTCA
GATGAGTTGGGTTCGAGTTGA