Details for Capsella Locus Carubv10016617m

Position : scaf_5 ( 5`- 11159464 .. 11163678 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016617m

Protein [Map View]
MGRADEFSVTGDSEAFSSARTSPYNSRSNTSQWKQHEGRYEDPPQVPFYPASLYPSSAYEYGYSSPSHGSHVSALEQPYY
HHQPNQFKQYGREGWRQESSVASPTHFPGATLEGKYYPRSSQSPRHDLQYHNLYESSSSATPHRSEYSERSYQAAAAPHH
STYSKHSVGIYKSDTSSEKRSLKGKKRYVGKRNHVVKHHILPSAGGAPFATCSYCLEILQLPQVSPKGKHKRYQVRCGSC
SGILKFSNRGKADTILDSPSFLDSDMGIADETVINHQDSAIEGHEEIYLDGSHLSCLDDDFGDTICKSTNDVILSRSLET
FEDKGIKEDRENLSSILLDSQLEALQPDLKPLVNHRLRKQQPASSDTIAETSRIYLEQSQEAHSEKSTEMDNSIFERVVC
NLEESEYEKREIIKPKVIVGEGSAEFLEVPVYKNKMRSESREEAERVAEKSISHSEELLYKNEYICETSSLSENTKDTEV
TRENEEYGDESTWEEIIGDKHQMHLEKSQYIGDSIYDSSLRYGETFEDTSVKEDTEKISNAYSDAMPATPQSSLESLVNE
NQRFIEHHDQSCEAIVTTSMINEKSKHEYENLREKQDLEMTISDRVRYELEESIHETNETLEESKVGEDRYSDYIENANG
AGEKRLVSYQMDSPRRNLKNSYGTLEPVYLEGSGFSGEKTWEETMEDRAGLQLEEYESNYEYYSRSFCMHDYELVTILEP
DEDPDGRSKSISQISFNNDGGAEERGVRHVEEPQLVSDGKTEQLQVCEMEKDTVSLDLECGKESMKPDETFEWTSGRTLT
FRHHGCQVGKRHEPDEDADGRSGSSSRDFVNDTNSSKERAVIHENGAWLVDDHETKAGQVCIMAEDGPSLHLEKCKTEKM
ELDETLDPHDDIFRLSVDGTLEQKTMKLMSQDKQENPGTNFKQGDIDEDVREFSSHVTSEGHKSPSKMAEVDSEGEEEIP
GDHIKHYQKENEKSELTSEPYAHIYSTTEPSEIVGLRLALYQTQNSPLRSPLTSPIHTPIGSPLHYLMASQIRSPIASTM
HSHIVSRLRYPINSSGSLSDVSFLSKKS*

DNA
ATGGGAAGGGCTGACGAATTCAGTGTGACTGGTGATTCTGAAGCGTTTTCTTCAGCAAGAACCTCTCCGTATAACTCACG
CAGCAATACTTCGCAATGGAAACAACACGAGGGAAGATATGAAGACCCGCCTCAGGTTCCTTTTTATCCAGCAAGTCTTT
ATCCTTCTTCTGCATATGAATATGGCTACAGTAGTCCTTCTCACGGGTCTCACGTTTCTGCATTAGAGCAGCCTTACTAT
CATCATCAACCAAACCAATTCAAGCAATATGGACGAGAAGGCTGGCGTCAAGAATCTTCTGTTGCTTCACCTACCCATTT
TCCGGGTGCGACCTTAGAAGGAAAATACTATCCTCGGTCTTCTCAGTCTCCGCGACATGATCTTCAGTATCATAATCTGT
ATGAATCCAGTAGCTCTGCAACCCCGCATCGTTCTGAGTACTCTGAGCGTAGTTATCAAGCAGCTGCAGCGCCACATCAC
TCCACGTACTCCAAGCATTCAGTAGGGATTTATAAGAGTGACACAAGTAGTGAGAAGAGATCTTTGAAGGGAAAAAAACG
GTATGTCGGGAAAAGGAATCATGTGGTGAAGCACCATATTCTTCCTTCAGCTGGTGGTGCGCCTTTTGCTACTTGTTCCT
ATTGTTTGGAAATTCTACAGCTTCCTCAGGTGTCTCCCAAAGGAAAACATAAGAGATATCAAGTGAGATGTGGCAGTTGT
TCCGGTATACTTAAGTTCTCTAATCGAGGGAAAGCAGATACTATCCTGGATTCACCTAGCTTTCTGGATTCTGACATGGG
TATTGCTGATGAGACTGTTATTAATCATCAGGATTCAGCTATAGAAGGCCACGAAGAGATTTACCTGGATGGAAGTCATC
TGTCATGTTTAGACGATGATTTTGGAGATACTATCTGCAAAAGCACGAATGATGTTATATTGAGCCGAAGTTTGGAAACA
TTTGAGGATAAGGGGATTAAAGAAGACAGAGAGAACTTATCCAGCATTTTATTAGATTCACAATTGGAGGCATTGCAGCC
TGATCTGAAACCTTTGGTGAACCACAGATTAAGGAAGCAACAACCTGCATCAAGTGATACTATTGCAGAGACTTCAAGAA
TTTATCTAGAGCAGTCTCAGGAAGCTCATTCAGAAAAGTCAACCGAGATGGATAATAGCATTTTTGAAAGAGTTGTTTGC
AATTTAGAAGAGTCGGAATATGAGAAGAGAGAAATTATTAAGCCAAAAGTTATAGTTGGAGAAGGATCAGCTGAGTTCCT
GGAGGTTCCAGTCTACAAGAACAAAATGAGGAGTGAATCAAGAGAAGAAGCCGAGAGAGTTGCAGAGAAATCAATATCTC
ATAGTGAGGAACTTCTATACAAAAACGAATACATCTGTGAAACAAGCTCACTGTCTGAAAATACTAAAGACACTGAGGTG
ACTCGAGAAAATGAAGAATATGGAGATGAAAGTACATGGGAAGAAATCATAGGAGACAAACACCAGATGCATTTAGAGAA
ATCGCAGTACATTGGAGATTCGATCTATGACAGTAGCTTACGTTATGGTGAAACATTTGAGGATACATCAGTCAAAGAAG
ATACAGAGAAAATATCAAACGCATATTCAGATGCAATGCCAGCTACACCACAGTCTTCTCTGGAATCTTTGGTGAACGAG
AACCAGAGATTTATAGAACATCATGACCAATCATGTGAGGCTATAGTAACAACATCCATGATCAATGAGAAATCCAAGCA
TGAGTATGAGAATTTAAGAGAAAAACAAGACTTGGAAATGACCATTAGTGACAGAGTCAGGTATGAGTTAGAGGAGTCTA
TACACGAGACCAATGAAACTCTTGAGGAGAGCAAGGTGGGCGAAGATAGGTATAGTGATTATATCGAGAATGCGAATGGG
GCAGGTGAAAAGAGATTGGTATCTTATCAGATGGATTCTCCACGGAGGAATTTAAAAAATTCTTATGGAACTCTAGAACC
AGTTTATCTAGAAGGAAGCGGGTTTTCAGGTGAAAAAACGTGGGAAGAGACAATGGAAGATAGAGCGGGGTTGCAATTGG
AGGAATATGAAAGCAACTATGAGTATTACAGCAGATCATTTTGCATGCATGATTATGAGCTAGTGACAATACTTGAACCA
GACGAGGATCCTGATGGAAGATCAAAGTCCATTTCACAAATTTCATTCAATAACGATGGAGGAGCAGAAGAAAGAGGCGT
GCGTCATGTGGAGGAGCCCCAGCTAGTGAGTGATGGCAAAACCGAACAGCTACAAGTATGTGAAATGGAGAAAGATACGG
TATCACTAGACTTGGAGTGTGGAAAAGAATCAATGAAACCAGATGAGACATTTGAATGGACTTCAGGGAGAACTTTGACA
TTTCGTCATCATGGATGTCAGGTAGGGAAAAGGCATGAACCAGACGAGGATGCTGATGGAAGGTCAGGATCTAGTTCAAG
GGATTTCGTGAATGATACCAACAGTTCAAAAGAAAGAGCTGTAATTCACGAGAATGGGGCTTGGCTGGTGGATGATCATG
AAACCAAAGCCGGACAAGTATGCATAATGGCAGAAGATGGACCATCACTACACTTGGAAAAGTGCAAAACTGAGAAAATG
GAATTGGACGAGACACTTGATCCACATGATGATATATTCAGGCTCAGTGTTGATGGCACACTTGAACAAAAGACAATGAA
GTTGATGTCTCAAGATAAGCAAGAAAATCCAGGGACGAACTTCAAACAAGGTGATATTGACGAAGATGTACGAGAATTTA
GTTCACATGTTACTTCAGAGGGCCATAAATCTCCAAGTAAAATGGCAGAGGTAGATAGTGAAGGTGAAGAGGAGATACCG
GGTGACCATATAAAGCATTATCAGAAAGAGAATGAGAAGTCAGAACTAACCTCTGAACCATATGCTCATATCTACAGCAC
AACAGAGCCTTCTGAAATCGTAGGTTTGCGTCTTGCGTTATACCAAACGCAAAATTCACCTCTACGGTCACCTCTCACGT
CACCAATTCATACTCCCATTGGTTCTCCACTGCATTACCTGATGGCTTCACAAATTCGTTCTCCAATAGCTTCAACAATG
CATTCTCACATAGTTTCACGGCTTCGTTATCCCATCAACTCATCCGGTTCATTATCTGATGTATCGTTCCTCAGCAAAAA
AAGTTGA