Details for Capsella Locus Carubv10016493m

Position : scaf_3 ( 5`- 6132570 .. 6133402 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016493m

Protein [Map View]
MSLQRPNNGNSSSSSSPKKHKTEESDEELLMVPDMEMEAAGSTCVLSSSADDGVTNPELDPTQNGVSTANKRRRGRNPVD
KEYRSLKRYNELIKMSTIIHSLQPVFVELKWLNNKKVVTTDC*

DNA
ATGTCTCTTCAACGACCTAACAACGGGAACTCGAGTTCTTCTTCTTCCCCCAAGAAGCACAAAACTGAGGAGAGTGACGA
GGAGTTGTTGATGGTTCCTGACATGGAAATGGAAGCAGCTGGATCGACATGCGTTCTAAGCAGCAGCGCCGACGATGGAG
TCACTAACCCGGAGCTTGACCCGACTCAAAACGGTGTCTCCACCGCTAATAAACGCCGCCGTGGACGTAACCCAGTTGAT
AAAGAGTATCGAAGCCTCAAGAGGTATAATGAGTTAATTAAAATGTCGACCATTATACATAGTTTGCAGCCAGTTTTTGT
GGAATTGAAATGGTTAAATAATAAGAAAGTGGTAACTACAGATTGTTGA