Details for Capsella Locus Carubv10016487m

Position : scaf_3 ( 5`- 5595744 .. 5596579 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016487m

Protein [Map View]
MLEGKAKVEETDMPVKMQMQAMRIASQSLDLFDVFDCTSIAAHIKKEFDERYGSGWQCVVGTNFGCFFTHSKGTFIYFHL
GTLNFLIFKGATL*

DNA
ATGTTGGAAGGGAAAGCCAAGGTGGAAGAGACAGACATGCCAGTGAAGATGCAAATGCAAGCAATGAGGATTGCTTCTCA
ATCCCTCGATCTTTTTGATGTCTTTGACTGTACATCCATAGCTGCTCACATCAAGAAGGAGTTTGATGAGAGATATGGAA
GTGGATGGCAATGTGTGGTGGGAACCAATTTTGGGTGTTTCTTCACACATTCTAAAGGGACTTTCATCTATTTTCATTTG
GGGACTCTCAACTTCCTCATCTTCAAAGGCGCCACTCTTTAG