Details for Capsella Locus Carubv10016486m

Position : scaf_3 ( 5`- 3341547 .. 3341975 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016486m

Protein [Map View]
KDVFKKTYEDYKLPESKWEMDEIMKYHLWGNECVMGNVLYVYDGYNYILRTCDLKQRTWGMVKGLENLPLGDYLSKLVCC
GNMLILFLRILDRDDTIVWKRKIWCVEISVERREGQIWGKVECCDLLLDGHFDITKSIVVTL*

DNA
AAGGACGTCTTCAAGAAAACCTATGAGGATTACAAACTACCGGAAAGTAAATGGGAGATGGATGAGATCATGAAGTATCA
TTTGTGGGGAAATGAATGTGTTATGGGCAACGTATTGTACGTCTACGATGGCTATAACTATATTTTACGAACATGTGATC
TCAAGCAAAGAACTTGGGGGATGGTGAAGGGCCTCGAAAATCTTCCCTTAGGTGATTATCTATCAAAACTAGTCTGTTGC
GGTAATATGTTGATATTGTTTTTGAGAATCTTGGACCGTGATGATACCATTGTTTGGAAAAGGAAAATATGGTGTGTGGA
GATTTCAGTGGAGAGGCGTGAAGGACAGATTTGGGGAAAGGTTGAGTGTTGCGATCTTTTGCTTGATGGCCATTTTGACA
TTACTAAATCTATTGTTGTTACTCTCTGA