Details for Capsella Locus Carubv10016485m

Position : scaf_3 ( 5`- 6151370 .. 6152560 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016485m

Protein [Map View]
MKSKRSMEATHPPPPQLPSLSDLEARMQILRVSAFEESKGDGDTFAQRAEWFYQRRPLLLSLCLDLYNGYITLLGRSSHP
TKPNLQLIKPTVSHPNHLLQEDDHDECISDIDSLSEISFDSNLSFQQRRDSSAVSDKVDELVSQLVTANLDKEIVQHELL
HKEQQFHEASKTIELLKKFVMLLEMEKEVAVEENANLGYKLTSLLEENRELATEALFMKNEAVGLARCVLKMRDDHFHKV
CLLQNRIYSLQRNSEPTYDKVSSGCFGLDKYKTKKKKENKSEEKTGFRWLKKLTTINFFTKCSLNPSAAAPSCCTFDLPI
A*

DNA
ATGAAGAGCAAAAGATCCATGGAAGCTACTCATCCTCCTCCTCCACAGTTGCCATCTCTCTCCGATCTTGAAGCTCGGAT
GCAAATCCTGCGTGTGTCTGCTTTTGAAGAAAGCAAAGGAGATGGTGATACTTTTGCTCAACGAGCTGAATGGTTTTACC
AGAGACGACCTCTCCTTCTCTCCCTTTGTCTTGACCTCTACAACGGCTACATCACTCTCTTAGGTCGTTCTTCTCACCCT
ACCAAACCTAATCTGCAGCTTATTAAACCCACAGTTTCTCATCCTAATCACCTTCTCCAAGAAGACGACCACGACGAATG
CATTTCAGACATTGATTCTCTTAGTGAGATCAGTTTCGACAGCAACTTGTCCTTCCAACAGAGGCGAGATTCTTCTGCGG
TTTCAGATAAAGTGGATGAGCTTGTATCTCAACTTGTGACCGCTAACTTGGATAAAGAGATTGTGCAACACGAGTTACTT
CACAAAGAGCAACAGTTTCACGAAGCCTCCAAGACTATTGAGCTGTTGAAGAAGTTCGTCATGCTGCTGGAGATGGAGAA
GGAAGTTGCTGTGGAGGAAAACGCTAATCTTGGCTACAAGCTCACTTCTCTCTTGGAGGAGAACAGAGAGCTTGCCACAG
AGGCATTGTTCATGAAGAATGAAGCTGTTGGGCTCGCTCGGTGTGTGCTTAAGATGAGAGATGATCATTTTCACAAGGTC
TGCCTTCTCCAAAACCGCATCTACTCACTTCAGAGGAACTCAGAGCCCACCTATGATAAGGTCTCATCCGGATGCTTTGG
CCTGGATAAGTATAAGACCAAAAAGAAGAAGGAGAACAAATCCGAAGAGAAAACTGGATTCAGGTGGTTGAAGAAGCTGA
CCACCATTAACTTCTTTACAAAGTGCAGCCTTAACCCATCAGCTGCTGCTCCATCATGCTGCACTTTCGACTTGCCTATA
GCTTAA