Details for Capsella Locus Carubv10016481m

Position : scaf_3 ( 5`- 5118203 .. 5119441 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016481m

Protein [Map View]
MSQETAIANFKKFQESWIEALRHHLNHLRSAQNHHRNSATGDEERLREAVESVMEHFRAYHRAKWATTEKDVIGVMAAPW
SSALERSLHWVGGWRPTTLFHLVYTESSILFESRIVDILRGFRTGDLSDLSPSQFRIKFVKGRTVSEIQCETVKEENAIT
EELSEWQDDASELVMGTSSDSDQRIRRLAEIVHQTDDLRMRTITRVVELLSPLQQAEFLIAAAELRMGVAGWGTSHDRRR
SSNV*

DNA
ATGAGCCAAGAGACAGCGATTGCGAACTTCAAGAAATTCCAAGAGTCATGGATCGAGGCGCTACGACATCACCTGAACCA
CCTCCGGTCTGCCCAAAATCACCACCGGAACTCTGCTACCGGCGACGAGGAACGGCTGAGGGAAGCGGTTGAGAGTGTGA
TGGAACACTTTAGAGCGTACCACAGGGCGAAGTGGGCGACGACGGAGAAAGACGTGATTGGTGTTATGGCTGCTCCTTGG
TCTTCCGCTCTTGAACGCTCGCTCCATTGGGTCGGTGGTTGGCGACCAACCACCTTGTTTCATCTGGTTTATACTGAGTC
CAGTATTTTGTTCGAGTCTCGTATCGTTGATATACTTCGTGGCTTTCGTACCGGTGATCTTAGCGATCTCTCTCCTTCTC
AGTTCAGGATTAAATTTGTCAAAGGCAGGACGGTGAGTGAGATACAATGTGAGACGGTGAAGGAAGAGAACGCGATAACG
GAAGAGTTATCGGAGTGGCAAGACGATGCGAGCGAACTCGTCATGGGAACATCATCCGACTCCGACCAGAGGATCCGACG
TCTAGCAGAAATCGTTCACCAAACCGATGATCTACGGATGAGAACGATCACACGCGTGGTGGAACTCCTTAGTCCGCTCC
AACAAGCGGAGTTTCTTATCGCTGCTGCTGAGCTTCGTATGGGCGTTGCTGGCTGGGGGACTAGCCACGACCGTCGTCGA
AGTTCCAACGTTTGA