Details for Capsella Locus Carubv10016479m

Position : scaf_3 ( 5`- 13549213 .. 13549998 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016479m

Protein [Map View]
MVSSHVIRSFLLLFVVYVYLYRTSFSNTEPEANITIDVRQAQKLLDSGYTFLDVRTVEEFEKGHVDSEKVFNVPYWLYTP
HGQVINPNFLKHVSSVCNQTDRLVVGCKSGVRSLYATKVLVSSGFKTVKNMDGGYIAWVNKSFPVIVEHKQLKYDEL*

DNA
ATGGTTTCTTCACACGTTATAAGATCTTTTCTTCTTCTTTTCGTTGTTTATGTTTATCTTTATCGCACGAGTTTCTCAAA
CACAGAACCAGAAGCTAATATTACGATCGATGTGAGGCAAGCTCAGAAGCTTCTTGATTCTGGCTACACTTTTCTTGATG
TCAGAACTGTTGAAGAATTCGAGAAAGGCCATGTTGATTCAGAGAAAGTCTTCAATGTTCCATACTGGTTATATACACCA
CATGGTCAAGTGATTAACCCTAATTTTTTGAAACATGTTTCATCTGTCTGCAACCAAACCGATCGTCTCGTCGTGGGTTG
TAAATCTGGAGTTAGATCACTGTATGCTACCAAAGTTCTTGTCTCTTCTGGCTTCAAGACTGTAAAAAACATGGACGGTG
GTTACATTGCTTGGGTCAACAAGAGTTTTCCAGTTATAGTGGAACACAAGCAACTCAAATACGATGAGCTCTGA