Details for Capsella Locus Carubv10016475m

Position : scaf_3 ( 5`- 2636624 .. 2645012 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016475m

Protein [Map View]
MAAANAPITMKEILTLPSVGINQQFITFTNVTMESDKYICVRETAPQNSVVIIDMNMPMQPLRRPITADSALMNPNSRIL
ALKAQVPGTTQDHLQIFNIEAKAKLKSHQMPEQVVFWKWITPKMLGLVTQNSVYHWSIEGDSEPVKMFDRTANLANNQII
NYKCSPNEKWLVLIGIAPGSPERQQLVKGNMQLFSVDQQRSQALEAHAASFAQFKVLLGSLVSSFYGLILSCSLTCNIII
VRFLGMRILLFLYHLQARALMLDNTSKLHVIELGAQPGKPSFTKKQADLFFPPDFADDFPVAMQVSHKFNLIYVITKLGL
LFVYDLETASAIYRNRISPDPIFLTSEASSVGGFYAINRRGQVLLATVNEATIIPFISGQLNNLELAVNLAKRGNLPGAE
NLVVQRFQELFAQTKYKEAAELAAESPQGILRTPDTVAKFQSVPVQAGQTPPLLQYFGTLLTRGKLNSYESLELSRLVVN
QNKKNLLENWLAEDKLECSEELGDLVKTVDNDLALKIYIKARATPKVVAAFAERREFDKILIYSKQVGYTPDYLFLLQTI
LRTDPQGAVNFALMMSQMEGGCPVDYNTITDLFLQRNLIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTFPNVADAIL
ANGMFSHYDRPRVAQLCEKAGLYIQSLKHYSELPDIKRVIVNTHAIEPQALVEFFGTLSSDWAMECMKDLLLVNLRGNLQ
IIVQACKEYCEQLGVDACIKLFEQFKSYEGLYFFLGSYLSMSEDPEIHFKYIEAAAKTGQIKEVERVTRESNFYDAEKTK
NFLMEAKLPDARPLINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLILSVRSLL
PVEPLVEECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDSNNNPEHFLTTNPYYDSKVVGKYCEKRDPTLAVVA
YRRGQCDEELINVTNKNSLFKLQARYVVERMDGDLWDKVLDENNDYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADL
PHELIELLEKIVLQNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLFEEAFAIFKKFNLNVQ
AVNVLLDNVRSIERAVEFAFRVEEDSVWSQVAKAQLREGLVSDAIESFIRADDATHFLEVIRVSEDTDVYDDLVKYLLMV
RQKVKEPKVDSELIYAYAKIDRLGEIEEFILMPNVANLQNVGDRLYDEALYEAAKIIYAFISNWGKLAVTLVKLQQFQGA
VDAARKANSAKTWKEVCFACVDAEEFRLAQICGLNIIIQVDDLEEVSEYYQNRGCFNELISLIESGLGLERAHMGIFTEL
GVLYARYRYEKLMEHIKLFSTRLNIPKLIRACDEQQHWQELTYLYIQYDEFDNAATTVMNHSPEAWEHMQFKDIVAKVAN
VELYYKAVHFYLQEHPDLINDLLNVLALRLDHTRVVDIMRKAGHLRLIKPYMIAVQSNNVSAVNEALNEIYVEEEDYDRL
RESIDLHDSFDQIGLAQKIEKHELVEMRRVAAYIYKKAGRWKQSIALSKKDNMYKDCMETASQSGEHELAEQLLVYFIEQ
DKKECFATCLFVCYDLIRPDVALELAWINNMMDFAFPYLLQFMREYSGKVDELIKDKLEAQKEVKAKEQEEKEVMSQQNM
YAQLLPLALPAPPMPGMGGGGGYGPPPTMGGMPGMPPMPAYGMPPMGGGY*

DNA
ATGGCAGCAGCCAACGCCCCCATTACGATGAAGGAGATCCTGACGCTTCCGAGCGTCGGGATCAATCAGCAATTCATCAC
GTTTACTAATGTTACTATGGAATCTGACAAGTACATCTGTGTACGCGAGACGGCACCACAAAACAGTGTTGTAATCATAG
ATATGAATATGCCGATGCAGCCTCTAAGGAGGCCTATTACTGCAGACTCTGCTCTTATGAATCCAAACTCGAGGATCCTT
GCCTTAAAAGCCCAAGTTCCAGGAACTACTCAGGATCATCTACAGATATTTAACATTGAAGCAAAAGCAAAGTTGAAGTC
GCATCAGATGCCTGAGCAGGTTGTCTTTTGGAAGTGGATTACACCAAAGATGTTGGGGCTGGTTACGCAGAATTCCGTTT
ACCATTGGTCAATCGAAGGTGATTCTGAGCCAGTTAAGATGTTTGATAGAACGGCAAATTTGGCCAACAATCAAATTATA
AACTATAAGTGCTCTCCTAATGAGAAGTGGTTGGTTTTAATTGGAATTGCTCCTGGCTCTCCTGAGAGACAACAATTAGT
AAAAGGAAATATGCAGCTTTTCTCTGTGGATCAACAGCGAAGCCAGGCCCTGGAGGCACATGCTGCTTCATTTGCACAGT
TTAAGGTACTACTTGGTTCTTTGGTGAGTTCATTCTATGGTCTAATCTTGAGCTGTAGTTTGACTTGCAACATTATTATT
GTTAGGTTCCTGGGAATGAGAATCCTTCTATTCTTATATCATTTGCAAGCAAGAGCTTTAATGCTGGACAATACATCAAA
GTTGCATGTCATTGAGCTTGGTGCCCAACCCGGAAAACCATCTTTTACAAAAAAGCAAGCCGATCTCTTTTTCCCCCCTG
ATTTTGCTGATGATTTTCCTGTCGCCATGCAGGTCTCTCACAAATTTAACTTGATATATGTTATAACCAAGCTTGGCCTG
TTGTTTGTATACGATCTAGAGACTGCTTCTGCTATCTACAGAAACCGGATTAGTCCAGACCCAATTTTTCTGACTTCTGA
AGCTTCTTCAGTTGGGGGTTTCTATGCCATTAATAGGCGAGGACAAGTTCTTTTGGCTACAGTAAACGAGGCTACCATTA
TACCTTTCATTAGTGGCCAATTGAACAATTTGGAGCTTGCTGTCAATCTTGCTAAAAGAGGAAACCTCCCAGGTGCAGAA
AATCTGGTTGTCCAGCGGTTCCAAGAGTTGTTCGCTCAAACAAAGTACAAGGAGGCTGCTGAGCTTGCTGCTGAATCTCC
TCAAGGAATTCTAAGGACACCTGATACAGTGGCCAAATTCCAGAGTGTTCCTGTACAAGCTGGGCAAACTCCTCCATTGT
TACAGTATTTTGGGACACTTTTAACTAGAGGGAAGCTCAATTCATATGAGTCACTTGAACTATCTCGGCTTGTTGTGAAC
CAAAACAAGAAGAACCTGCTGGAAAACTGGTTGGCAGAGGATAAGCTAGAATGCAGTGAAGAACTTGGAGACCTTGTCAA
GACTGTGGATAATGATCTTGCTCTGAAAATATACATCAAAGCTCGGGCGACTCCAAAAGTTGTAGCAGCTTTTGCAGAAA
GAAGGGAGTTTGACAAAATACTGATTTACTCAAAGCAGGTTGGGTACACACCTGATTATCTGTTTCTTCTGCAAACCATA
CTCCGTACAGATCCTCAGGGAGCAGTAAATTTTGCATTAATGATGTCTCAAATGGAAGGAGGTTGTCCAGTTGATTACAA
CACCATTACTGATCTTTTTCTTCAGAGAAATCTGATCCGAGAAGCGACTGCTTTCCTTTTGGATGTGCTGAAGCCAAATT
TACCTGAGCATGCTTTTCTACAAACTAAGGTTCTGGAGATCAATTTGGTAACCTTTCCTAATGTGGCCGATGCTATATTA
GCAAATGGAATGTTCAGCCACTATGACCGGCCTCGTGTAGCTCAACTTTGTGAAAAGGCTGGACTTTATATTCAATCATT
GAAGCATTACTCCGAGTTACCTGATATAAAACGTGTAATTGTGAACACACATGCTATTGAGCCACAGGCTCTTGTTGAGT
TTTTTGGTACTCTTTCTAGCGATTGGGCAATGGAATGCATGAAGGATCTGTTGCTGGTCAACCTGAGAGGCAATCTCCAG
ATAATCGTTCAGGCTTGCAAGGAGTACTGTGAACAACTAGGTGTTGATGCATGTATTAAGCTCTTTGAGCAGTTCAAGTC
ATACGAAGGGCTATACTTTTTCCTAGGTTCATATTTGAGTATGAGTGAGGATCCTGAGATTCACTTTAAGTACATTGAAG
CAGCTGCCAAGACTGGACAAATCAAGGAGGTTGAGCGTGTAACTAGAGAGTCTAACTTCTATGACGCTGAAAAGACGAAA
AACTTTTTGATGGAAGCTAAGCTGCCTGATGCACGACCTTTGATAAATGTCTGCGACCGTTTCGGCTTTGTGCCTGATCT
AACTCATTACCTCTACACAAACAACATGCTTCGTTACATTGAAGGTTACGTACAAAAGGTGAACCCTGGGAATGCTCCCT
TAGTTGTGGGACAGCTTCTTGACGATGAATGCCCTGAAGATTTTATAAAAGGCCTCATTCTCTCTGTTCGTTCATTGCTT
CCTGTTGAACCACTTGTCGAGGAATGCGAGAAGAGAAATCGTCTTCGTCTCCTCACTCAGTTCTTGGAGCATCTAGTTAG
TGAGGGAAGCCAAGATGTGCATGTCCATAATGCCTTGGGTAAAATTATCATAGACAGTAACAACAACCCTGAGCATTTCT
TGACCACCAACCCTTACTACGACTCTAAGGTGGTTGGTAAGTACTGCGAGAAACGTGATCCTACCCTTGCAGTTGTGGCA
TACAGAAGAGGACAATGTGACGAGGAGCTTATCAATGTCACTAACAAAAACTCTCTGTTTAAGTTACAAGCCAGGTATGT
AGTGGAGAGGATGGATGGTGACCTCTGGGATAAGGTTCTCGATGAAAACAATGATTATAGAAGACAACTTATTGACCAGG
TTGTGTCTACTGCTTTACCTGAAAGCAAGAGCCCGGAGCAGGTTTCTGCAGCTGTTAAAGCATTCATGACTGCTGATTTG
CCGCACGAGCTTATTGAGCTTCTTGAAAAGATCGTTCTTCAAAATTCTGCCTTCAGTGGGAATTTCAATCTGCAAAATCT
GCTTATATTGACTGCTATTAAGGCAGATCCATCAAGAGTTATGGATTACATTAACAGGCTGGACAACTTTGATGGACCTG
CTGTTGGAGAAGTTGCAGTCGAAGCCCAATTGTTTGAGGAAGCATTTGCAATCTTCAAGAAGTTTAACTTAAATGTTCAG
GCTGTCAATGTATTGCTTGATAATGTCAGAAGCATTGAGCGGGCAGTTGAGTTTGCTTTCCGAGTCGAAGAAGATTCTGT
TTGGAGCCAAGTAGCTAAGGCGCAACTCAGGGAAGGACTCGTCAGTGATGCAATTGAGTCCTTTATCCGTGCTGATGATG
CCACTCATTTCTTGGAGGTCATACGTGTCTCTGAAGATACTGATGTCTATGATGACTTGGTCAAATACCTTCTGATGGTT
AGACAGAAGGTGAAAGAACCCAAGGTTGACAGTGAGCTTATCTATGCATATGCGAAGATCGATAGGTTAGGTGAGATTGA
AGAATTCATTCTGATGCCAAATGTTGCCAATCTACAAAATGTTGGTGATCGCCTGTATGATGAAGCTCTCTATGAGGCTG
CAAAAATAATTTATGCGTTCATATCAAACTGGGGTAAGTTAGCTGTCACACTTGTGAAATTGCAACAGTTCCAAGGTGCT
GTTGATGCTGCAAGAAAAGCAAACAGTGCAAAGACATGGAAGGAAGTGTGCTTTGCTTGTGTTGATGCAGAGGAATTCCG
GTTGGCCCAAATCTGTGGTCTTAACATTATCATTCAGGTGGATGACCTGGAGGAAGTCAGTGAGTACTACCAGAACAGAG
GGTGCTTCAATGAATTAATCTCACTTATAGAGAGTGGACTTGGGCTGGAACGTGCCCACATGGGTATCTTCACCGAGTTG
GGTGTACTCTATGCTAGATATCGTTATGAGAAACTTATGGAACACATCAAGTTATTTTCAACTCGCCTCAATATTCCTAA
GCTTATACGAGCCTGTGATGAACAACAGCACTGGCAGGAACTTACCTATCTGTACATTCAGTACGATGAGTTTGATAATG
CTGCGACCACTGTCATGAACCATTCTCCTGAAGCTTGGGAGCACATGCAATTCAAAGACATTGTTGCGAAGGTAGCAAAT
GTTGAATTGTACTACAAGGCTGTGCACTTCTACTTGCAAGAGCATCCTGATCTAATCAACGATCTTCTGAACGTGCTTGC
GTTGCGGTTAGACCACACTCGTGTTGTTGATATAATGCGGAAGGCTGGTCACTTGCGTCTTATCAAGCCATACATGATTG
CAGTTCAGAGCAACAATGTCTCTGCTGTTAATGAGGCTCTGAATGAGATATATGTAGAAGAAGAAGACTATGATAGGTTG
CGCGAGTCTATTGATCTACATGACAGTTTTGACCAGATTGGTCTCGCTCAGAAGATCGAGAAACATGAGCTTGTTGAAAT
GAGGCGTGTGGCCGCTTATATCTACAAGAAAGCGGGCAGATGGAAGCAATCAATTGCATTATCAAAGAAAGACAACATGT
ACAAGGACTGTATGGAAACTGCTTCACAATCTGGCGAACATGAACTTGCAGAACAATTACTGGTGTATTTCATTGAACAG
GACAAAAAGGAATGCTTTGCCACATGTCTCTTTGTATGTTATGACTTAATCCGACCAGACGTGGCTCTAGAACTTGCCTG
GATCAACAATATGATGGACTTTGCCTTCCCGTATCTCCTCCAGTTTATGCGAGAATACTCTGGCAAAGTGGATGAGCTAA
TAAAGGACAAGCTGGAGGCACAAAAAGAAGTGAAGGCCAAAGAGCAGGAAGAGAAGGAGGTCATGTCCCAACAGAACATG
TACGCCCAACTATTACCACTTGCATTACCTGCACCACCGATGCCTGGAATGGGAGGTGGTGGTGGGTATGGTCCGCCACC
AACAATGGGGGGCATGCCAGGAATGCCTCCTATGCCAGCATATGGAATGCCACCGATGGGAGGCGGCTACTAA