Details for Capsella Locus Carubv10016468m

Position : scaf_3 ( 5`- 1635143 .. 1636112 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016468m

Protein [Map View]
MLVYQDLLTGDELLSDSFPYKELENGMLWEVEGKWVVKGAMDFDIGANPSAEEGGEEEGVDDQAVKVVDIIDTFRLQEQP
SFDKKQFVMFMKRYIKQLSPKLDSEKQELFKKHIESATKFLMSKLKDFQFFVGESMEGEQGSLVFAYYREGATDPTFLYL
AYGLKEIKC*

DNA
ATGTTGGTTTACCAAGATCTTCTTACAGGCGATGAGCTTCTCTCTGATTCCTTTCCTTACAAGGAACTCGAGAACGGCAT
GTTATGGGAAGTTGAAGGAAAGTGGGTTGTGAAAGGAGCTATGGATTTTGACATTGGTGCGAATCCATCGGCTGAAGAAG
GCGGTGAAGAAGAGGGAGTCGATGATCAAGCTGTGAAGGTTGTTGATATCATCGATACTTTTAGGCTTCAGGAGCAACCA
TCGTTTGACAAGAAACAGTTTGTTATGTTCATGAAAAGATACATAAAGCAACTAAGCCCTAAGCTAGACTCGGAAAAGCA
AGAGCTGTTCAAGAAACACATTGAGAGTGCCACCAAATTTTTGATGTCAAAGCTCAAAGACTTCCAATTCTTTGTGGGAG
AGAGCATGGAAGGAGAACAAGGGAGCTTAGTGTTTGCTTACTACAGAGAAGGAGCCACCGATCCTACTTTCCTCTACTTG
GCCTACGGCTTGAAGGAGATCAAGTGCTGA