Details for Capsella Locus Carubv10016467m

Position : scaf_3 ( 5`- 3596165 .. 3598282 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016467m

Protein [Map View]
MAAPTVRSSGSSFSRNISVVSSPQIPGLKCGPNGTTFISTGIRDLDRILGGGYPLGSLVMVMEDPEAPHHMDLLRTFMSQ
GLVNNQPLLYASPSKDPRGFLGTLPHPGSSKEDNKPTAPEPDQNLCDDFHRNSNNIASVGRIAIQSFCSPLCEYSEKETD
MLSFIRLLKSMLMVSNAVAIVTFPPSLLSPSSSKRLQHMADTLLSIKAIPDGDKELEKLLTGYKDINGFLNIHKVARINT
QVPVILEAKTFSMSLKKRRFLALECLNQAPVDGSSGTSYGTSGSCSGSSKSGALDF*

DNA
ATGGCTGCACCCACCGTTCGTAGTAGTGGCAGCAGCTTCTCTCGCAATATATCAGTTGTGTCATCACCTCAGATACCTGG
TCTCAAGTGCGGTCCTAATGGCACAACCTTTATATCAACTGGAATTCGTGATCTTGACAGGATATTAGGTGGTGGCTATC
CTTTAGGGAGCTTAGTAATGGTGATGGAAGATCCTGAAGCACCGCATCATATGGATCTCTTAAGAACTTTCATGTCTCAG
GGTCTTGTTAACAACCAACCACTTCTTTATGCTAGTCCTTCGAAAGATCCGAGAGGGTTTCTTGGCACTTTGCCGCATCC
TGGATCGTCTAAAGAGGATAATAAGCCTACTGCACCCGAGCCTGATCAGAACCTGTGTGATGATTTCCACAGAAACAGTA
ATAACATTGCATCCGTTGGTCGCATCGCAATCCAGTCATTCTGCTCTCCCTTGTGTGAATATTCTGAAAAGGAAACAGAC
ATGCTTTCGTTTATAAGACTGTTGAAAAGTATGTTGATGGTTTCAAATGCGGTAGCCATTGTCACTTTCCCGCCTTCCCT
GCTCTCCCCATCTTCCTCAAAAAGACTGCAGCACATGGCGGACACCTTACTCTCTATCAAAGCAATCCCAGATGGTGACA
AGGAATTGGAGAAACTCCTCACTGGCTACAAAGACATAAATGGATTCCTCAACATACACAAGGTTGCTCGTATCAATACA
CAGGTGCCTGTAATTCTTGAGGCAAAAACCTTCTCAATGAGCTTGAAGAAGAGAAGATTCTTGGCTCTAGAGTGTCTGAA
TCAAGCCCCTGTAGACGGGTCCAGTGGAACATCATATGGTACATCGGGGAGCTGCTCAGGATCATCCAAATCCGGAGCAC
TCGATTTTTGA