Details for Capsella Locus Carubv10016464m

Position : scaf_3 ( 5`- 8435108 .. 8437667 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016464m

Protein [Map View]
MPSVQRLKKTEVAKCLTCPLCHNLFEVATTINECLHTFCWKCIHSNFTAQNLPACPVCDTHLGSYPDEKLRVDHHKNAMK
EKLFPSKKKGVKAGPETVAASSESCEMKETPLTSLMDSSSGVPSSSAAPLVPTTVVLALPAASARPYRAIKKRYKKTIAL
KKNDTGKESEQPPPKETTVKKVYLFDLNKEPDEELDEAESSRSHDSGTIQGLSDLCKSLCDTVAPLEININTPVAIEPAL
TSNGVASNGLDSIQNNCVVNREANEVPVQVNENTILISSDRGTEEVSGQKLKNNGKGKQECASSSRPSRNRRGDNKGMVP
NNSYALRPRKDGRAATPAASSTPEALVSVETIGEVVEGPNNNGVWFKLVPLRIRDGNVTVSQVKKFLMKKVGFQTEDEVE
IWLGDEPVCSSQTLCYLLNWFIQITPVPEGPVMVGDSAVDYLMPLHYSYKSGSGSASGSGSGSASGSGSGSGSASASGSG
SGSG*

DNA
ATGCCTTCAGTACAACGACTGAAGAAGACGGAGGTTGCTAAATGCTTAACATGTCCTCTCTGCCATAACCTTTTCGAAGT
TGCAACTACCATCAACGAGTGCCTTCACACCTTTTGCTGGAAGTGCATACATTCCAACTTCACAGCACAGAATCTGCCAG
CTTGTCCAGTCTGTGATACTCATCTTGGATCTTACCCTGACGAGAAACTTCGGGTGGATCACCACAAGAATGCTATGAAA
GAAAAACTCTTCCCATCAAAGAAAAAAGGCGTAAAGGCAGGACCTGAAACTGTTGCAGCCTCTTCGGAATCTTGCGAAAT
GAAAGAAACGCCTTTAACTTCACTCATGGACTCTTCATCTGGAGTACCATCCTCATCTGCTGCTCCATTGGTGCCCACTA
CGGTTGTGCTAGCTCTTCCGGCTGCCAGTGCCAGGCCTTACCGCGCCATTAAGAAACGTTACAAGAAAACTATAGCTCTT
AAGAAGAATGATACTGGTAAAGAATCAGAACAGCCTCCTCCTAAGGAGACTACTGTTAAGAAGGTTTATCTGTTTGATCT
CAACAAAGAACCAGATGAAGAACTGGACGAAGCTGAATCATCAAGATCTCATGATAGTGGAACGATTCAAGGTTTATCTG
ATCTTTGTAAGTCCTTGTGTGATACTGTGGCGCCACTAGAAATCAACATTAATACTCCTGTGGCTATTGAACCAGCGCTA
ACTTCGAATGGGGTGGCTTCAAATGGTCTTGACAGTATTCAAAACAACTGTGTTGTGAATAGAGAAGCAAATGAAGTCCC
AGTCCAAGTGAATGAGAACACTATCCTTATCAGCTCTGATAGGGGTACAGAGGAGGTCTCTGGTCAGAAACTAAAGAACA
ATGGTAAAGGGAAACAAGAATGTGCTAGCAGCTCCAGGCCAAGTAGGAATAGGAGGGGTGATAACAAGGGGATGGTGCCA
AATAATAGTTATGCTTTGAGACCCCGAAAAGACGGGAGGGCGGCTACTCCAGCAGCTAGTTCTACACCAGAAGCTTTGGT
TTCCGTGGAAACGATAGGGGAAGTTGTTGAAGGACCTAATAATAATGGAGTTTGGTTTAAACTAGTGCCTTTAAGGATTA
GAGATGGAAACGTGACTGTGTCACAAGTCAAGAAGTTTCTAATGAAAAAGGTCGGTTTCCAAACCGAAGACGAGGTGGAG
ATATGGCTAGGGGATGAGCCAGTGTGTTCTTCACAGACACTATGTTACTTGTTAAATTGGTTCATTCAAATAACTCCAGT
TCCTGAAGGTCCAGTGATGGTTGGAGACTCCGCTGTTGATTACCTCATGCCTCTCCACTACAGTTACAAATCTGGCTCAG
GCTCTGCCTCCGGCTCCGGCTCTGGCTCTGCCTCCGGCTCAGGCTCAGGCTCAGGCTCTGCCTCTGCCTCCGGGTCTGGG
TCTGGGTCTGGATAA