Details for Capsella Locus Carubv10016463m

Position : scaf_3 ( 5`- 3295290 .. 3296072 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016463m

Protein [Map View]
MKKKKVHHSDDEEDDTFYYRYSSVAAPPPSNPKQPSSSAKSSAPGGSGGLAPSKSTLYVSNLDFSLTNSDIHTLFSTFGK
VARVTVLKDRHTRRSRGVAFVLYVSREDAAKASGSMDGKILNGRKLTVSIAADNGRASEFIKKRVYKDKSRCYECGDEGH
LSYECPRNQLGPRERPPPPKKRGRRKEDGGEAEETREWSAAPPSLAVAEETFEEENWASVVDNEAGERLRMREAEEEEER
RKKRKEKKVSYFSDESDDED*

DNA
ATGAAGAAGAAGAAGGTTCACCATAGCGACGATGAAGAGGACGACACTTTCTACTATCGCTACTCTTCCGTCGCGGCACC
ACCTCCGTCGAACCCTAAACAACCTTCTTCATCCGCCAAATCATCAGCTCCTGGCGGATCTGGCGGCTTAGCTCCTTCGA
AATCAACCCTCTACGTCTCCAATCTCGACTTCTCCCTCACCAATTCCGACATCCACACTCTCTTCTCCACCTTCGGCAAG
GTCGCTCGTGTCACTGTTCTCAAGGATCGCCACACTCGCCGCTCACGTGGCGTCGCGTTCGTGCTCTATGTCTCTCGTGA
AGACGCGGCTAAAGCGTCGGGTTCCATGGACGGAAAGATTCTTAACGGTCGGAAGTTGACGGTTTCGATCGCCGCAGATA
ACGGACGTGCGTCGGAGTTTATTAAGAAGAGAGTGTACAAGGATAAGTCGAGGTGTTACGAGTGTGGAGACGAAGGGCAT
CTTTCCTATGAGTGCCCTAGAAATCAATTGGGTCCAAGGGAGAGACCACCGCCGCCTAAGAAAAGGGGCCGGCGGAAGGA
GGACGGCGGAGAGGCTGAGGAAACTAGGGAGTGGTCTGCGGCGCCGCCCTCGTTAGCTGTGGCGGAGGAGACATTTGAGG
AGGAGAATTGGGCTTCGGTGGTGGATAACGAAGCTGGAGAGAGGTTGAGAATGAGAGAAGCAGAGGAAGAAGAAGAGAGG
AGGAAGAAGCGAAAGGAGAAGAAAGTTAGTTACTTTAGTGATGAGAGTGATGATGAAGATTAG