Details for Capsella Locus Carubv10016449m

Position : scaf_3 ( 5`- 2852775 .. 2854279 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016449m

Protein [Map View]
MANNAAKPKFSLRLLIDEEKNRVVLAEAGKDFVDVLCSLLTLPMGTIVRLLEKHQNPQSSIVGCFHNLYKSVSGMDVDNF
ETHACKNLLMYPRSAKASYCRKLKLNIDDTEVTKFFVCPNFISTEACSKKYSNVSTSRCSCGSSMTREIQVEGEQADGCL
GDKADGVFVSCRTSFVITDDLKVALNSMGLVLNVLNDLGYAGFDKLQEMVIDVGFEEVLTLLGCLFTSEAPLTDSLLRKH
CMARKRKMLTPSVQETGITTGEADKLLTLKVYVRKTDRVILYAECREDFVDFLFTFLAIPLGFAWELSLDNVNMGCVGNL
CRSLKGLSFEQPEKSKVFKFVLPFFYDCRPQFLDVDVEEIPEYECLINRKSYGCSKLCKKYQKNVLAQGERIAKMISMDS
KISVASDSTSMRLVKGETNFIVSDDLVVNPMNSSSTVSLLSKLQMSISDIEEQVISFGKSEVRDPLHSII*

DNA
ATGGCTAATAACGCTGCAAAACCGAAGTTTAGCTTGAGACTTCTCATTGATGAGGAGAAAAACAGAGTTGTTTTGGCTGA
AGCTGGGAAGGATTTTGTTGATGTACTCTGTAGTCTTTTGACTCTCCCTATGGGTACCATTGTAAGGTTGCTGGAGAAGC
ATCAGAATCCGCAGTCTTCAATCGTTGGTTGTTTCCACAACCTTTACAAAAGTGTTTCAGGAATGGACGTTGATAACTTT
GAGACTCACGCTTGTAAGAATTTGTTGATGTATCCACGGAGTGCTAAGGCGAGTTATTGCAGAAAGCTAAAGCTGAACAT
TGATGACACAGAGGTGACCAAGTTCTTTGTCTGCCCGAATTTTATATCTACTGAAGCATGCTCTAAGAAATACAGTAATG
TTAGTACCTCGAGGTGTAGTTGTGGAAGCTCAATGACCCGCGAGATTCAGGTTGAAGGAGAGCAAGCTGATGGTTGTTTA
GGAGACAAAGCTGACGGAGTATTTGTCAGCTGCCGAACGTCATTTGTCATCACCGATGATCTGAAAGTGGCATTGAACTC
TATGGGTCTTGTGCTGAACGTCCTCAATGACCTTGGCTATGCTGGTTTTGATAAGCTGCAAGAAATGGTTATTGATGTTG
GTTTTGAAGAGGTGCTAACTTTGCTAGGCTGTTTATTCACTTCTGAAGCTCCTTTGACAGACTCATTACTGAGGAAACAT
TGTATGGCAAGGAAACGTAAAATGTTGACACCTTCGGTGCAAGAAACTGGAATTACTACAGGAGAAGCTGACAAACTTTT
AACTTTGAAAGTTTACGTTAGAAAGACAGACAGGGTGATTCTTTATGCAGAGTGCAGAGAAGATTTTGTTGATTTTCTTT
TCACTTTTCTAGCCATCCCGCTTGGGTTTGCTTGGGAACTTTCTCTTGACAATGTGAATATGGGCTGCGTTGGTAATCTG
TGCAGAAGCCTGAAGGGGTTGAGCTTTGAGCAGCCGGAAAAATCCAAAGTTTTCAAATTCGTGCTTCCTTTTTTTTACGA
TTGTCGACCACAATTCCTTGATGTTGATGTCGAGGAAATTCCCGAGTATGAATGTTTAATTAACAGAAAAAGTTATGGTT
GTAGCAAGCTCTGCAAAAAGTATCAGAAGAACGTGCTGGCCCAAGGTGAAAGAATTGCCAAGATGATTTCAATGGATTCA
AAAATCAGTGTCGCTTCAGATTCAACTAGTATGAGACTTGTGAAGGGAGAAACGAATTTCATAGTTTCAGATGATCTGGT
TGTCAATCCTATGAACTCGTCCTCAACCGTTTCATTACTAAGCAAGTTGCAGATGAGCATTAGCGATATCGAGGAGCAAG
TGATTAGCTTTGGCAAATCTGAAGTACGAGACCCTCTGCATTCTATCATCTAA