Details for Capsella Locus Carubv10016445m

Position : scaf_3 ( 5`- 7434643 .. 7435818 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016445m

Protein [Map View]
MDNDLDLTLKLGLPNSTVETNLSLNTSTTTSTITTDQDTNDDRREDNNNNDGGRGDKNNNGGGEVFNLCRAIWGDNKVSN
DEGARRSNVDMNIRVYNYIFQQFAGAPNTLNFDTYPMPPPPGSAPAPVTRPEREAYVLIDVPASRAQRNNAMLMANAWSE
SPSSYGKRLRVGCDGGYCGGRAEGPRKCTNKNCNALTTPMWRRGPLGPKSLCNACGIKFRKEQERKAKRN*

DNA
ATGGACAACGATTTGGACTTAACACTGAAGTTAGGTTTGCCGAATTCGACTGTTGAGACAAATCTCAGCTTAAACACTTC
AACCACCACTTCCACCATCACCACTGATCAGGATACCAACGACGACCGTCGTGAGGACAACAACAACAACGACGGTGGCC
GTGGAGACAAAAACAACAACGGCGGTGGCGAGGTTTTCAACCTATGTAGGGCTATCTGGGGAGATAATAAAGTGAGCAAC
GACGAAGGTGCAAGAAGAAGCAACGTGGACATGAATATTAGAGTCTACAATTACATCTTTCAACAGTTCGCCGGCGCCCC
CAACACTCTAAACTTCGACACCTACCCAATGCCTCCGCCTCCGGGATCGGCACCGGCTCCAGTGACTCGTCCGGAGAGAG
AAGCGTATGTTCTGATCGATGTTCCTGCTAGTAGAGCTCAACGTAACAACGCTATGTTGATGGCAAACGCTTGGAGCGAA
AGCCCGAGCTCGTACGGCAAGAGGCTTCGCGTCGGTTGCGATGGTGGCTACTGCGGCGGAAGGGCTGAAGGGCCGAGGAA
ATGTACGAACAAGAACTGTAACGCACTTACCACACCTATGTGGCGAAGGGGTCCTCTTGGTCCTAAGAGTTTGTGCAATG
CTTGTGGGATCAAGTTCAGGAAGGAGCAAGAGAGGAAAGCCAAAAGAAACTGA