Details for Capsella Locus Carubv10016444m

Position : scaf_3 ( 5`- 1025859 .. 1028320 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016444m

Protein [Map View]
MKSLVVAHFSTPLITSTSRLLFPLCLNHRASFSAVSFPTVRRRYSPLAMASSAQSSSQAVSSGSADSDTDVFKLIQAHEE
KAARLSPVEEIRTVLNGSLCGMLSTFSQKYEGYPSGSMVDFACDADGSPILAVSSLAVHTKDLLANPKCSLLIARDPEDR
TGLRITLHGDAVLVSEKDQAAVRSAYLAKHPNAFWVDFGDFSLMRIEPKVVRYVSGVATAFLGSGEFSKEEFQAAKVDPI
AQYAKPVMSHMNKDHEEDTIAIVHNITSIPVESALMLDLDSLGFNVKATLQGNSFKLRVPFPRRAQDRKDVKTLIVEMLQ
AAKSVSN*

DNA
ATGAAGTCGCTTGTAGTGGCCCATTTCTCAACGCCTTTAATCACTTCTACTTCTAGATTGTTGTTCCCTTTATGTCTTAA
TCATCGAGCTTCATTCTCCGCCGTCTCTTTCCCCACCGTCCGCCGCCGATATTCTCCTCTCGCCATGGCCTCATCAGCTC
AGTCCTCTTCTCAGGCTGTGTCTTCCGGGAGTGCCGACAGTGATACAGATGTTTTTAAATTGATTCAAGCTCACGAGGAG
AAGGCTGCTCGTCTTTCCCCAGTCGAAGAAATCCGAACTGTGCTTAATGGTAGCCTCTGCGGTATGCTTTCCACTTTTTC
TCAGAAGTATGAGGGTTATCCTTCAGGGTCAATGGTTGATTTTGCATGTGATGCTGATGGTTCTCCGATTCTGGCAGTTA
GTAGCTTGGCAGTTCATACAAAGGATCTTTTAGCTAATCCAAAATGCTCACTACTAATTGCTAGAGACCCAGAGGATAGG
ACCGGTTTGAGGATCACCCTACATGGTGATGCAGTGTTGGTTTCTGAAAAAGATCAAGCAGCTGTTCGATCTGCCTATTT
AGCCAAGCATCCCAATGCTTTCTGGGTTGATTTCGGGGACTTCAGCCTTATGCGAATCGAACCGAAAGTGGTCAGATATG
TTTCAGGGGTTGCAACTGCTTTTCTGGGATCTGGAGAATTCAGCAAAGAGGAGTTCCAAGCAGCCAAAGTTGATCCTATA
GCTCAGTATGCAAAGCCTGTAATGTCTCACATGAACAAAGATCATGAAGAGGATACCATAGCCATTGTACACAATATAAC
ATCCATACCTGTGGAGAGCGCCTTGATGCTAGATTTGGACAGCCTTGGTTTCAACGTTAAGGCTACTCTTCAAGGGAACT
CCTTCAAACTCCGAGTTCCATTCCCAAGACGCGCACAAGACAGAAAGGATGTGAAGACACTGATAGTGGAAATGCTTCAA
GCCGCCAAATCTGTTTCCAATTAG