Details for Capsella Locus Carubv10016442m

Position : scaf_3 ( 5`- 7950975 .. 7952396 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016442m

Protein [Map View]
MSPSIEPKCDHCATAQAVIYCKSDLAKVCLNCDVHVHSANPLSHRHTRSLICQKCFSQPAVIRCLDDKVSYCQGCHWHAS
DCSVLGHTLQSLNPFSGCPSPTDFNRMWSSILEPSFSGLVSPLVGSLPLNDPNNNTAFGMAKINELDGLIASSYSLVSHN
NISYTQSFSDQSSFFSDESKGCPDFVLELEDDLCEELNLDNAPLNFDVGDDIIRFSSEEPDHMVPKCLFSDKDNTSVTAS
NFTIDKALETTSPGQQDCTNYLSGPFQMNINTIGLPLPPSPVLFGQIHPTMSPTISNITGESSAADYRMSPGFIMSEAPW
ESNLELPCPQARNQAKLRYKEKRLKRSFGKQIRYASRKARADSRKRVKGRFVKAGDNYDYDPSSPPNNQ*

DNA
ATGTCTCCAAGTATAGAGCCAAAGTGTGACCACTGTGCAACCGCACAAGCTGTGATTTACTGCAAATCTGATTTGGCTAA
AGTTTGCCTAAACTGCGACGTCCATGTACACTCTGCGAATCCTCTGTCTCACAGACACACACGCTCTTTGATCTGCCAGA
AATGCTTCTCACAACCAGCTGTGATTCGCTGTCTCGACGATAAGGTATCGTACTGCCAAGGATGCCACTGGCATGCAAGC
GATTGCTCGGTGTTAGGACATACACTTCAGAGCTTAAATCCTTTCTCTGGTTGTCCTTCTCCAACAGATTTTAATAGAAT
GTGGTCTTCAATTCTTGAACCTTCCTTCTCTGGTTTGGTCAGTCCGTTAGTTGGTTCTTTGCCCTTGAATGATCCCAACA
ATAATACAGCGTTTGGAATGGCGAAAATCAACGAATTAGATGGTTTGATCGCTTCCTCTTATTCCTTGGTGTCACACAAC
AACATCAGTTACACTCAGAGTTTTAGTGATCAATCATCTTTCTTTTCCGATGAATCTAAGGGATGTCCTGATTTTGTTCT
TGAACTTGAAGATGATCTATGCGAAGAGCTAAACCTGGATAATGCGCCGTTAAACTTTGACGTTGGAGATGATATCATCA
GATTTTCATCAGAAGAACCAGACCATATGGTACCAAAGTGCCTATTCAGCGACAAGGATAACACATCCGTTACCGCCTCG
AACTTTACTATAGACAAGGCTTTAGAGACAACTTCACCAGGACAGCAAGATTGCACTAACTATCTGTCAGGTCCGTTTCA
AATGAACATCAACACTATTGGACTTCCTCTTCCTCCATCACCTGTCTTGTTCGGACAAATCCATCCGACCATGTCGCCTA
CCATCTCCAACATCACAGGTGAAAGCAGTGCAGCGGATTATAGGATGTCTCCAGGGTTTATAATGAGTGAAGCCCCATGG
GAATCGAATCTTGAACTTCCTTGTCCACAAGCAAGGAACCAGGCTAAGTTGAGATACAAGGAGAAGAGACTAAAGCGCTC
GTTTGGGAAACAGATTCGATATGCATCTCGCAAAGCGAGAGCTGACTCGAGAAAAAGAGTGAAAGGAAGATTTGTGAAAG
CTGGCGACAATTATGATTATGACCCATCATCTCCGCCGAATAACCAATGA