Details for Capsella Locus Carubv10016434m

Position : scaf_3 ( 5`- 672921 .. 674521 -3` )
Annotation :
External links : CoGe
PGDD synteny : Carubv10016434m

Protein [Map View]
MGRSPCCDESGLKKGPWTPEEDQKLIYHIRKHGHGSWRALPKQAGLNRCGKSCRLRWTNYLRPDIKRGNFTAEEEQTIIN
LHSLLGNKWSSIAGHLPGRTDNEIKNYWNTHIRKKLMQMGIDPVTHRPRTDHLNVLAALPQLLAAANFNNLLNLNQNIQL
DATSVAKAQLLHSMIQVLSNNNNASSSLETHHTNNNNLFGQSSFLENLPSIGENLYDQTQSLSHIVNQPPLDSFTSPIRV
VAHQDYQNSIPPLISASPDDESKQTQMMAKNKEVLRHTDHTSNPSSTSTFTQDHQPWCDVIDDEASDSYWKDIIEQTCSE
TWPFRE*

DNA
ATGGGGAGATCACCGTGTTGCGATGAGAGCGGATTAAAGAAAGGGCCATGGACACCAGAGGAGGATCAGAAACTGATTTA
TCATATAAGAAAACATGGCCATGGAAGCTGGAGAGCTCTTCCAAAGCAAGCCGGTTTAAACCGGTGTGGAAAGAGTTGCA
GGTTGAGATGGACTAATTACTTGAGACCAGACATCAAGAGAGGAAACTTCACAGCTGAGGAAGAGCAGACCATCATCAAC
CTCCATTCTCTTCTTGGAAACAAGTGGTCGTCTATAGCTGGTCATCTCCCAGGAAGAACGGATAACGAAATAAAGAACTA
TTGGAACACTCATATTAGAAAGAAACTAATGCAGATGGGGATTGATCCAGTGACCCATCGGCCGAGAACCGACCATCTAA
ACGTTCTAGCCGCTCTCCCGCAACTACTAGCTGCCGCAAATTTCAACAACCTCTTGAATCTAAATCAAAATATACAACTG
GACGCAACAAGTGTTGCAAAAGCACAGTTGTTACATAGTATGATTCAAGTCCTTAGCAACAATAACAATGCCTCTTCGTC
ACTTGAAACTCATCACACCAACAACAACAACCTCTTTGGCCAATCTTCTTTCTTGGAGAACCTACCAAGTATCGGTGAAA
ATCTTTATGATCAAACCCAAAGCCTCTCCCACATTGTTAATCAGCCGCCTCTGGATTCGTTTACTAGCCCCATTCGTGTA
GTTGCTCATCAAGATTATCAGAATTCTATTCCACCGTTGATTTCGGCATCTCCTGATGATGAGTCTAAGCAAACCCAAAT
GATGGCCAAGAATAAGGAAGTTCTGAGGCATACTGATCACACTTCAAACCCTTCATCGACCTCAACGTTCACCCAAGATC
ATCAGCCATGGTGTGACGTAATTGATGACGAAGCAAGTGATTCTTATTGGAAAGATATCATAGAGCAAACTTGTTCGGAG
ACTTGGCCATTTCGTGAATAG